@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00186_DYR_MO: (2014-08-30 )
MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKFEVYEKKD

Atome Classification :

(56 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

06U_A_4(4KAK)
DYR_HUMAN
[Raw transfer]




06U_B_10(4KAK)
DYR_HUMAN
[Raw transfer]




DTM_D_4(1MVS)
DYR_HUMAN
[Raw transfer]




21V_A_2(4M6L)
DYR_HUMAN
[Raw transfer]




1R0_A_4(4KFJ)
DYR_HUMAN
[Raw transfer]




3TZ_A_2(3NTZ)
DYR_HUMAN
[Raw transfer]




D2E_A_3(3NXT)
DYR_HUMAN
[Raw transfer]




DH3_C_3(2FZJ)
DYR_MOUSE
[Raw transfer]




3TU_A_3(3NU0)
DYR_HUMAN
[Raw transfer]




D2D_A_7(3NXR)
DYR_HUMAN
[Raw transfer]




FOL_B_10(4KFJ)
DYR_HUMAN
[Raw transfer]




1QZ_A_4(4KEB)
DYR_HUMAN
[Raw transfer]




FOL_B_6(2W3M)
DYR_HUMAN
[Raw transfer]




684_A_7(3S7A)
DYR_HUMAN
[Raw transfer]




D2H_A_3(3NXY)
DYR_HUMAN
[Raw transfer]




VG9_A_4(2W3B)
DYR_HUMAN
[Raw transfer]




51P_A_2(3GYF)
DYR_HUMAN
[Raw transfer]




D2D_A_3(3NXX)
DYR_HUMAN
[Raw transfer]




D2Q_A_2(3NZD)
DYR_HUMAN
[Raw transfer]




FOL_A_4(2W3M)
DYR_HUMAN
[Raw transfer]




9DR_A_4(4KD7)
DYR_HUMAN
[Raw transfer]




DH1_A_2(3F8Y)
DYR_HUMAN
[Raw transfer]




DTM_D_4(1MVT)
DYR_HUMAN
[Raw transfer]




9DR_B_8(4KD7)
DYR_HUMAN
[Raw transfer]




51P_A_3(3K45)
DYR_MOUSE
[Raw transfer]




FOL_B_6(4KEB)
DYR_HUMAN
[Raw transfer]




D2F_A_2(3NXV)
DYR_HUMAN
[Raw transfer]




FOL_A_2(4M6K)
DYR_HUMAN
[Raw transfer]




25U_A_3(4KBN)
DYR_HUMAN
[Raw transfer]




DH1_A_2(3FS6)
DYR_HUMAN
[Raw transfer]




VG9_B_8(2W3B)
DYR_HUMAN
[Raw transfer]




GOL_X_3(3D84)
DYR_MOUSE
[Raw transfer]




TOP_A_6(2W3A)
DYR_HUMAN
[Raw transfer]




25U_B_15(4KBN)
DYR_HUMAN
[Raw transfer]




TOP_B_9(2W3A)
DYR_HUMAN
[Raw transfer]




DZF_B_4(2DHF)
DYR_HUMAN
[Raw transfer]




MMV_A_3(4DDR)
DYR_HUMAN
[Raw transfer]




D2N_X_2(3NZB)
DYR_PNECA
[Raw transfer]




GW3_A_4(1AOE)
DYR_CANAX
[Raw transfer]




N22_A_5(3CSE)
?
[Raw transfer]




D09_A_2(3K47)
DYR_MOUSE
[Raw transfer]




FOL_A_3(1DHF)
DYR_HUMAN
[Raw transfer]




GHW_A_2(3GHW)
DYR_HUMAN
[Raw transfer]




OAG_A_2(4G95)
?
[Raw transfer]




GHW_A_2(3GI2)
DYR_HUMAN
[Raw transfer]




MTX_B_2(1U70)
DYR_MOUSE
[Raw transfer]




39B_B_7(2C2T)
DYR_HUMAN
[Raw transfer]




NDP_A_3(3K47)
DYR_MOUSE
[Raw transfer]




WRA_A_4(3RG9)
DRTS_TRYBB
[Raw transfer]




DZF_A_3(2DHF)
DYR_HUMAN
[Raw transfer]




NDP_A_3(1AOE)
DYR_CANAX
[Raw transfer]




NDP_B_7(2W3B)
DYR_HUMAN
[Raw transfer]




NAP_A_3(4KEB)
DYR_HUMAN
[Raw transfer]




NAP_A_3(4M6L)
DYR_HUMAN
[Raw transfer]




NAP_B_2(2FZJ)
DYR_MOUSE
[Raw transfer]




NDP_A_2(3NXY)
DYR_HUMAN
[Raw transfer]




NDP_C_3(1U70)
DYR_MOUSE
[Raw transfer]




NDP_A_3(3GHW)
DYR_HUMAN
[Raw transfer]




NAP_X_2(3D84)
DYR_MOUSE
[Raw transfer]




NDP_A_2(3NU0)
DYR_HUMAN
[Raw transfer]




NDP_A_3(2W3M)
DYR_HUMAN
[Raw transfer]




NDP_A_3(2W3B)
DYR_HUMAN
[Raw transfer]




NDP_A_3(3GYF)
DYR_HUMAN
[Raw transfer]




NDP_A_2(4DDR)
DYR_HUMAN
[Raw transfer]




NAP_X_3(3NZB)
DYR_PNECA
[Raw transfer]




NAP_A_3(4M6K)
DYR_HUMAN
[Raw transfer]




NDP_B_8(2W3A)
DYR_HUMAN
[Raw transfer]




NDP_A_3(3GI2)
DYR_HUMAN
[Raw transfer]




NDP_B_5(2W3M)
DYR_HUMAN
[Raw transfer]




NAP_B_5(4KEB)
DYR_HUMAN
[Raw transfer]




NDP_A_3(3FS6)
DYR_HUMAN
[Raw transfer]




NAP_A_4(3NRR)
?
[Raw transfer]




NDP_A_3(3NXV)
DYR_HUMAN
[Raw transfer]




NDP_B_6(2C2T)
DYR_HUMAN
[Raw transfer]




NDP_A_3(3NTZ)
DYR_HUMAN
[Raw transfer]




NAP_A_3(3CSE)
?
[Raw transfer]




NDP_A_3(3NZD)
DYR_HUMAN
[Raw transfer]




NAP_A_3(4KAK)
DYR_HUMAN
[Raw transfer]




NAP_A_12(4KBN)
DYR_HUMAN
[Raw transfer]




NAP_B_9(4KAK)
DYR_HUMAN
[Raw transfer]




NDP_A_2(3K45)
DYR_MOUSE
[Raw transfer]




NAP_A_3(4KFJ)
DYR_HUMAN
[Raw transfer]




NDP_A_3(3F8Y)
DYR_HUMAN
[Raw transfer]




NAP_B_7(4KD7)
DYR_HUMAN
[Raw transfer]




NAP_B_9(4KFJ)
DYR_HUMAN
[Raw transfer]




NDP_A_4(2W3A)
DYR_HUMAN
[Raw transfer]




NAP_B_(4KBN)
DYR_HUMAN
[Raw transfer]




NDP_A_2(3D80)
DYR_MOUSE
[Raw transfer]




NAP_A_3(4KD7)
DYR_HUMAN
[Raw transfer]




NDP_A_2(3NXR)
DYR_HUMAN
[Raw transfer]




NDP_A_4(3QG2)
?
[Raw transfer]




NDP_A_6(1J3K)
DRTS_PLAFK
[Raw transfer]




NDP_A_2(3NXX)
DYR_HUMAN
[Raw transfer]




NDP_A_2(4M6J)
DYR_HUMAN
[Raw transfer]




NDP_A_2(2BL9)
DRTS_PLAVI
[Raw transfer]




NDP_A_2(3NXT)
DYR_HUMAN
[Raw transfer]




WRA_A_5(1J3K)
DRTS_PLAFK
[Raw transfer]




D16_A_5(3NRR)
?
[Raw transfer]




CP6_A_3(3QG2)
?
[Raw transfer]




ATR_A_3(4KLX)
DYR_MYCTU
[Raw transfer]




CP6_A_3(2BL9)
DRTS_PLAVI
[Raw transfer]




Q22_A_3(3D80)
DYR_MOUSE
[Raw transfer]




EOH_A_5(4KAK)
DYR_HUMAN
[Raw transfer]




2 PsiBlast_PDB 97.60100%-134 - C3 -3D80 10.6 DYR_MOUSE
4 PsiBlast_PDB 96.77100%-129 - C3 -3K47 11.3 DYR_MOUSE
5 PsiBlast_PDB 96.4699%-131 - C3 -3K45 12.5 DYR_MOUSE
6 PsiBlast_PDB 95.8099%-129 - C3 -1U70 10.3 DYR_MOUSE
1 PsiBlast_PDB 95.49100%-136 - C3 -2FZJ 9.9 DYR_MOUSE
24 PsiBlast_CBE 95.4689%-137 - C3 -4KEB 12.1 DYR_HUMAN
3 PsiBlast_PDB 95.20100%-131 - C3 -3D84 11.1 DYR_MOUSE
16 PsiBlast_CBE 95.0789%-137 - C3 -2W3A 11.3 DYR_HUMAN
12 PsiBlast_CBE 94.3489%-137 - C3 -2W3M 12.1 DYR_HUMAN
23 PsiBlast_CBE 94.3389%-131 - C3 -4KFJ 12.5 DYR_HUMAN
30 PsiBlast_CBE 94.1089%-138 - C3 -4KAK 11.5 DYR_HUMAN
14 PsiBlast_CBE 94.0789%-135 - C3 -2W3B 11.7 DYR_HUMAN
22 PsiBlast_CBE 94.0489%-134 - C3 -4KFJ 12.1 DYR_HUMAN
48 Fugue 93.9590%-138 - C3 -1DHF 8.0 DYR_HUMAN
17 PsiBlast_CBE 93.8789%-134 - C3 -2W3A 11.2 DYR_HUMAN
13 PsiBlast_CBE 93.8489%-135 - C3 -2W3M 12.4 DYR_HUMAN
37 PsiBlast_CBE 93.6089%-131 - C3 -3NXX 12.1 DYR_HUMAN
29 PsiBlast_CBE 93.5889%-133 - C3 -4KBN 11.7 DYR_HUMAN
46 PsiBlast_CBE 93.3489%-133 - C3 -2C2T 12.2 DYR_HUMAN
15 PsiBlast_CBE 93.2589%-135 - C3 -2W3B 12.4 DYR_HUMAN
39 PsiBlast_CBE 93.2089%-130 - C3 -3NXT 11.0 DYR_HUMAN
31 PsiBlast_CBE 93.1989%-133 - C3 -4KAK 11.9 DYR_HUMAN
18 PsiBlast_CBE 92.9889%-128 - C3 -1MVT 7.1 DYR_HUMAN
28 PsiBlast_CBE 92.8489%-133 - C3 -4KBN 11.9 DYR_HUMAN
40 PsiBlast_CBE 92.8089%-131 - C3 -3NXR 11.6 DYR_HUMAN
32 PsiBlast_CBE 92.7789%-132 - C3 -4G95 6.8 ?
38 PsiBlast_CBE 92.6689%-132 - C3 -3NXV 10.2 DYR_HUMAN
19 PsiBlast_CBE 92.6089%-132 - C3 -1MVS 6.3 DYR_HUMAN
11 PsiBlast_CBE 92.5389%-129 - C3 -3FS6 11.2 DYR_HUMAN
41 PsiBlast_CBE 92.5189%-129 - C3 -3NU0 11.7 DYR_HUMAN
43 PsiBlast_CBE 92.4989%-131 - C3 -3GHW 11.7 DYR_HUMAN
25 PsiBlast_CBE 92.4089%-133 - C3 -4KEB 12.2 DYR_HUMAN
45 PsiBlast_CBE 92.2989%-137 - C3 -2DHF 8.7 DYR_HUMAN
7 PsiBlast_CBE 92.2789%-129 - C3 -4M6L 11.1 DYR_HUMAN
9 PsiBlast_CBE 92.2389%-129 - C3 -4M6J 12.6 DYR_HUMAN
36 PsiBlast_CBE 92.1689%-131 - C3 -3NXY 10.9 DYR_HUMAN
20 PsiBlast_CBE 92.0289%-129 - C3 -3GI2 11.4 DYR_HUMAN
42 PsiBlast_CBE 91.9989%-129 - C3 -3NTZ 12.0 DYR_HUMAN
8 PsiBlast_CBE 91.9289%-129 - C3 -4M6K 11.8 DYR_HUMAN
35 PsiBlast_CBE 91.4389%-128 - C3 -3NZD 6.7 DYR_HUMAN
10 PsiBlast_CBE 91.2889%-133 - C3 -3GYF 11.8 DYR_HUMAN
21 PsiBlast_CBE 91.2089%-127 - C3 -3F8Y 10.5 DYR_HUMAN
44 PsiBlast_CBE 91.0989%-132 - C3 -2DHF 9.2 DYR_HUMAN
27 PsiBlast_CBE 90.6589%-131 - C3 -4KD7 11.1 DYR_HUMAN
34 PsiBlast_CBE 90.5789%-134 - C3 -3S7A 9.0 DYR_HUMAN
26 PsiBlast_CBE 90.3389%-131 - C3 -4KD7 11.2 DYR_HUMAN
33 PsiBlast_CBE 88.9089%-124 - C3 -4DDR 11.2 DYR_HUMAN
64 HHSearch 66.6137%-124 - C3 -1AOE 12.6 DYR_CANAX
56 HHSearch 64.8037%-115 - C3 -3CSE 13.1 ?
61 HHSearch 60.9435%-101 - C3 -3NZB 11.5 DYR_PNECA
67 HHSearch 60.8733%-114 - C3 -3NRR 12.3 ?
60 HHSearch 57.5033% -99 - C3 -3RG9 6.5 DRTS_TRYBB
65 HHSearch 56.9634% -93 - C3 -1J3K 11.7 DRTS_PLAFK
68 HHSearch 54.8034% -85 - C3 -3QG2 9.9 ?
59 HHSearch 53.6235% -83 - C3 -2BL9 11.6 DRTS_PLAVI
66 HHSearch 51.5732%-115 - C3 -4KLX 8.6 DYR_MYCTU