@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00194_CAH1_H: (2014-08-31 )
ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

Atome Classification :

(35 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

M28_B_7(2NN1)
CAH1_HUMAN
[Raw transfer]




B30_A_5(2FOY)
CAH1_HUMAN
[Raw transfer]




M29_A_5(2NN7)
CAH1_HUMAN
[Raw transfer]




M29_B_6(2NN7)
CAH1_HUMAN
[Raw transfer]




TOR_A_4(3LXE)
CAH1_HUMAN
[Raw transfer]




M28_A_6(2NN1)
CAH1_HUMAN
[Raw transfer]




B30_B_6(2FOY)
CAH1_HUMAN
[Raw transfer]




M25_B_8(2NMX)
CAH1_HUMAN
[Raw transfer]




TOR_B_6(3LXE)
CAH1_HUMAN
[Raw transfer]




AAS_A_8(1CZM)
CAH1_HUMAN
[Raw transfer]




MZM_A_3(1BZM)
CAH1_HUMAN
[Raw transfer]




AZM_A_3(1AZM)
CAH1_HUMAN
[Raw transfer]




AZM_A_3(3ML5)
CAH7_HUMAN
[Raw transfer]




AZM_A_3(4LU3)
CAH14_HUMAN
[Raw transfer]




SUA_A_4(3K34)
CAH2_HUMAN
[Raw transfer]




AZM_A_5(3W6H)
CAH1_HUMAN
[Raw transfer]




ETS_A_4(3FW3)
CAH4_HUMAN
[Raw transfer]




AZM_B_8(3W6H)
CAH1_HUMAN
[Raw transfer]




GOL_A_7(3K34)
CAH2_HUMAN
[Raw transfer]




AZM_A_5(1JD0)
CAH12_HUMAN
[Raw transfer]




4MD_A_7(3DA2)
CAH13_HUMAN
[Raw transfer]




PPF_A_5(2IT4)
CAH1_HUMAN
[Raw transfer]




AZM_A_4(4G7A)
?
[Raw transfer]




AZM_A_6(3IAI)
CAH9_HUMAN
[Raw transfer]




EDO_A_5(1J9W)
CAH1_HUMAN
[Raw transfer]




EDO_B_6(1J9W)
CAH1_HUMAN
[Raw transfer]




E1F_B_4(4KNN)
CAH13_HUMAN
[Raw transfer]




EDO_B_13(1JV0)
CAH1_HUMAN
[Raw transfer]




EDO_A_12(1JV0)
CAH1_HUMAN
[Raw transfer]




ACY_A_8(1Y7W)
?
[Raw transfer]




ACY_A_11(1KEQ)
CAH5A_MOUSE
[Raw transfer]




HIS_B_6(2FW4)
CAH1_HUMAN
[Raw transfer]




FLB_E_5(3W6I)
CAH1_HUMAN
[Raw transfer]




FLB_B_6(3W6H)
CAH1_HUMAN
[Raw transfer]




FLB_A_3(3W6I)
CAH1_HUMAN
[Raw transfer]




FLB_A_3(3W6H)
CAH1_HUMAN
[Raw transfer]




TRS_A_8(2NN1)
CAH1_HUMAN
[Raw transfer]




TRS_B_6(2NMX)
CAH1_HUMAN
[Raw transfer]




TRS_B_6(2NMX)
CAH1_HUMAN
[Raw transfer]




4MZ_A_6(1KEQ)
CAH5A_MOUSE
[Raw transfer]




B30_A_5(2FOY)
CAH1_HUMAN
[Raw transfer]




TRS_A_8(2NN1)
CAH1_HUMAN
[Raw transfer]




FLB_A_3(3W6H)
CAH1_HUMAN
[Raw transfer]




PEG_A_7(4HT2)
CAH12_HUMAN
[Raw transfer]




M25_A_7(2NMX)
CAH1_HUMAN
[Raw transfer]




M25_B_8(2NMX)
CAH1_HUMAN
[Raw transfer]




M29_A_5(2NN7)
CAH1_HUMAN
[Raw transfer]




8 PsiBlast_PDB 98.62100% -80 - C2 -1CZM 3.0 CAH1_HUMAN
6 PsiBlast_PDB 98.46100% -80 - C2 -1AZM 3.6 CAH1_HUMAN
7 PsiBlast_PDB 98.20100% -77 - C2 -1BZM 3.3 CAH1_HUMAN
40 HHSearch 97.43100% -82 - C2 -2FOY 4.2 CAH1_HUMAN
4 PsiBlast_PDB 97.05100% -79 - C2 -2NN1 3.4 CAH1_HUMAN
16 PsiBlast_PDB 96.8699% -80 - C2 -1JV0 2.2 CAH1_HUMAN
28 PsiBlast_CBE 96.83100% -81 - C2 -2FOY 4.4 CAH1_HUMAN
12 PsiBlast_PDB 96.73100% -80 - C2 -3LXE 5.3 CAH1_HUMAN
22 PsiBlast_CBE 96.70100% -83 - C2 -3W6H 3.2 CAH1_HUMAN
21 PsiBlast_CBE 96.65100% -82 - C2 -3W6I 2.6 CAH1_HUMAN
14 PsiBlast_PDB 96.54100% -82 - C2 -3W6I 2.9 CAH1_HUMAN
25 PsiBlast_CBE 96.50100% -79 - C2 -2NN1 3.8 CAH1_HUMAN
27 PsiBlast_CBE 96.41100% -79 - C2 -2FW4 2.9 CAH1_HUMAN
26 PsiBlast_CBE 96.38100% -78 - C2 -2NMX 3.8 CAH1_HUMAN
5 PsiBlast_PDB 96.29100% -77 - C2 -2NN7 4.1 CAH1_HUMAN
3 PsiBlast_PDB 96.24100% -79 - C2 -2NMX 2.8 CAH1_HUMAN
29 PsiBlast_CBE 96.1899% -82 - C2 -1JV0 3.2 CAH1_HUMAN
13 PsiBlast_PDB 96.16100% -82 - C2 -3W6H 4.7 CAH1_HUMAN
24 PsiBlast_CBE 96.08100% -77 - C2 -2NN7 4.2 CAH1_HUMAN
23 PsiBlast_CBE 95.88100% -77 - C2 -3LXE 5.4 CAH1_HUMAN
19 PsiBlast_PDB 95.80100% -80 - C2 -2IT4 3.4 CAH1_HUMAN
30 PsiBlast_CBE 95.6699% -81 - C2 -1J9W 2.1 CAH1_HUMAN
15 PsiBlast_PDB 94.8999% -78 - C2 -1J9W 2.1 CAH1_HUMAN
44 HHSearch 85.9960% -79 - C2 -3K34 4.2 CAH2_HUMAN
41 HHSearch 85.4860% -73 - C2 -4KNN 3.9 CAH13_HUMAN
43 HHSearch 84.9652% -78 * C2 *3ML5 2.9 CAH7_HUMAN
20 PsiBlast_PDB 84.4460% -74 - C2 -3DA2 4.7 CAH13_HUMAN
46 HHSearch 76.9736% -80 - C2 -4HT2 1.9 CAH12_HUMAN
51 HHSearch 76.5448% -83 - C2 -1KEQ 2.7 CAH5A_MOUSE
47 HHSearch 75.7735% -76 - C2 -4LU3 2.9 CAH14_HUMAN
32 Fugue 74.0735% -77 - C2 -1JD0 2.4 CAH12_HUMAN
53 HHSearch 72.7433% -83 - C2 -3IAI 3.3 CAH9_HUMAN
45 HHSearch 66.3630% -61 - C2 -3FW3 4.1 CAH4_HUMAN
56 HHSearch 66.3135% -79 - C2 -4G7A 3.5 ?
58 HHSearch 59.8830% -64 - C2 -1Y7W 3.8 ?