@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00215_PYRF_M: (2014-09-01 )
MRSRRVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFRGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLLNP

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BMP_A_3(4MUZ)
PYRF_ARCFU
[Raw transfer]




BMP_A_3(3P5Z)
PYRF_METTH
[Raw transfer]




BMP_I_3(3NQD)
PYRF_METTH
[Raw transfer]




BMP_B_9(4O11)
?
[Raw transfer]




BMP_A_3(4O11)
?
[Raw transfer]




BMP_A_2(1LOR)
PYRF_METTH
[Raw transfer]




BMQ_A_3(3LHZ)
PYRF_METTH
[Raw transfer]




UP6_A_3(3G1A)
PYRF_METTH
[Raw transfer]




U_A_4(1KLZ)
PYRF_METTH
[Raw transfer]




BMP_A_3(3SIZ)
PYRF_METTH
[Raw transfer]




UP6_A_2(1KLY)
PYRF_METTH
[Raw transfer]




UP6_A_3(3SY5)
PYRF_METTH
[Raw transfer]




U5P_B_7(4NUW)
PYRF_METTH
[Raw transfer]




UP6_A_3(4NX5)
PYRF_METTH
[Raw transfer]




U5P_A_3(4NUW)
PYRF_METTH
[Raw transfer]




UP6_B_7(4NX5)
PYRF_METTH
[Raw transfer]




UP6_A_3(3PBV)
PYRF_METTH
[Raw transfer]




3DU_A_3(4NT0)
PYRF_METTH
[Raw transfer]




U_A_3(3G1D)
PYRF_METTH
[Raw transfer]




3DU_B_6(4NT0)
PYRF_METTH
[Raw transfer]




BMP_A_3(3LTP)
PYRF_METTH
[Raw transfer]




GOL_A_4(4MUZ)
PYRF_ARCFU
[Raw transfer]




GOL_A_3(3VE9)
?
[Raw transfer]




EDO_A_5(4NUW)
PYRF_METTH
[Raw transfer]




19 PsiBlast_PDB 95.6899%-132 - C1 -3P5Z 7.0 PYRF_METTH
16 PsiBlast_PDB 95.5399%-135 - C1 -3SY5 6.7 PYRF_METTH
9 PsiBlast_PDB 95.4999%-135 - C1 -4NX5 6.8 PYRF_METTH
34 PsiBlast_CBE 95.2199%-133 - C1 -4NX5 6.8 PYRF_METTH
33 PsiBlast_CBE 95.2199%-133 - C1 -4O11 6.6 ?
35 PsiBlast_CBE 95.0199%-133 - C1 -4NUW 6.7 PYRF_METTH
10 PsiBlast_PDB 94.8599%-135 - C1 -4O11 6.9 ?
37 PsiBlast_CBE 94.7799%-133 - C1 -3LTP - PYRF_METTH
8 PsiBlast_PDB 94.7399%-134 - C1 -4NUW 6.6 PYRF_METTH
15 PsiBlast_PDB 94.6799%-136 - C1 -3SIZ 7.0 PYRF_METTH
18 PsiBlast_PDB 94.4799%-136 - C1 -3PBV 6.0 PYRF_METTH
17 PsiBlast_PDB 94.2699%-135 - C1 -3NQD 6.9 PYRF_METTH
2 PsiBlast_PDB 93.8599%-130 - C1 -3G1A 7.1 PYRF_METTH
3 PsiBlast_PDB 93.5499%-132 - C1 -3G1D 6.9 PYRF_METTH
6 PsiBlast_PDB 93.4599%-133 - C1 -3LTP 7.2 PYRF_METTH
20 PsiBlast_PDB 92.9799%-131 - C1 -3LHZ 7.1 PYRF_METTH
7 PsiBlast_PDB 92.0199%-143 - C1 -4NT0 5.6 PYRF_METTH
36 PsiBlast_CBE 91.9699%-144 - C1 -4NT0 5.8 PYRF_METTH
13 PsiBlast_PDB 91.7399%-136 - C1 -1KLY 7.0 PYRF_METTH
12 PsiBlast_PDB 90.3199%-135 - C1 -1KLZ 6.9 PYRF_METTH
14 PsiBlast_PDB 89.8899%-132 - C1 -1LOR 7.0 PYRF_METTH
80 HHSearch 65.7440%-125 * C1 *4MUZ 7.0 PYRF_ARCFU
62 Fugue 51.3033%-105 - C1 -3VE9 2.9 ?