@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00248_AK1C1_: (2014-09-03 )
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Atome Classification :

(52 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BT9_B_6(4DBU)
AK1C3_HUMAN
[Raw transfer]




RUT_D_4(1RY8)
AK1C3_HUMAN
[Raw transfer]




RUT_F_6(1RY8)
AK1C3_HUMAN
[Raw transfer]




0HV_B_7(4DBS)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(4DBU)
AK1C3_HUMAN
[Raw transfer]




NAP_B_5(4DBU)
AK1C3_HUMAN
[Raw transfer]




IMN_A_3(3UG8)
AK1C3_HUMAN
[Raw transfer]




NPX_A_3(3UFY)
AK1C3_HUMAN
[Raw transfer]




IU5_E_5(1IHI)
AK1C2_HUMAN
[Raw transfer]




NDP_A_7(2HDJ)
AK1C2_HUMAN
[Raw transfer]




NPS_A_3(3R58)
AK1C3_HUMAN
[Raw transfer]




NAP_B_7(1J96)
AK1C2_HUMAN
[Raw transfer]




NAP_A_5(1J96)
AK1C2_HUMAN
[Raw transfer]




NAP_A_2(3GUG)
AK1C1_HUMAN
[Raw transfer]




NAP_A_8(1XJB)
AK1C2_HUMAN
[Raw transfer]




NAP_A_3(3C3U)
AK1C1_HUMAN
[Raw transfer]




FLR_A_3(3R94)
AK1C3_HUMAN
[Raw transfer]




ID8_A_3(3R43)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3NTY)
AK1C1_HUMAN
[Raw transfer]




0SL_A_3(4FA3)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(1MRQ)
AK1C1_HUMAN
[Raw transfer]




0T0_A_3(4FAL)
AK1C3_HUMAN
[Raw transfer]




SUZ_A_3(3R7M)
AK1C3_HUMAN
[Raw transfer]




511_B_7(4DBW)
AK1C3_HUMAN
[Raw transfer]




ZOM_A_3(3R8H)
AK1C3_HUMAN
[Raw transfer]




0HV_A_4(4DBS)
AK1C3_HUMAN
[Raw transfer]




BT9_A_4(4DBU)
AK1C3_HUMAN
[Raw transfer]




0SZ_B_12(4FAM)
AK1C3_HUMAN
[Raw transfer]




IU5_F_6(1IHI)
AK1C2_HUMAN
[Raw transfer]




511_A_4(4DBW)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(1AFS)
DIDH_RAT
[Raw transfer]




NAP_A_3(4DBS)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(4H7C)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3R58)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3H7U)
AKRC9_ARATH
[Raw transfer]




NAP_A_2(3UFY)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3R8G)
AK1C3_HUMAN
[Raw transfer]




NAP_A_4(2FGB)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(4HMN)
AK1C3_HUMAN
[Raw transfer]




NAP_A_4(3BUV)
AK1D1_HUMAN
[Raw transfer]




NAP_A_2(3R7M)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3R94)
AK1C3_HUMAN
[Raw transfer]




5P3_A_3(3NTY)
AK1C1_HUMAN
[Raw transfer]




NAP_A_2(3R43)
AK1C3_HUMAN
[Raw transfer]




NAP_B_6(4DBW)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3H7R)
AKRC8_ARATH
[Raw transfer]




NAP_A_3(4FAM)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3R6I)
AK1C3_HUMAN
[Raw transfer]




NAP_B_6(4DBS)
AK1C3_HUMAN
[Raw transfer]




NAP_B_11(4FAM)
AK1C3_HUMAN
[Raw transfer]




0SZ_A_4(4FAM)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(1S1P)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(4FA3)
AK1C3_HUMAN
[Raw transfer]




NAP_A_4(1ZQ5)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(4GIE)
PGFS_TRYCC
[Raw transfer]




NAP_C_3(1IHI)
AK1C2_HUMAN
[Raw transfer]




NDP_B_8(2HDJ)
AK1C2_HUMAN
[Raw transfer]




NAP_B_9(1XJB)
AK1C2_HUMAN
[Raw transfer]




NAP_A_6(2IPJ)
AK1C2_HUMAN
[Raw transfer]




NAP_D_4(1IHI)
AK1C2_HUMAN
[Raw transfer]




NDP_A_3(4IJR)
ARA1_YEAST
[Raw transfer]




FFA_A_8(2IPJ)
AK1C2_HUMAN
[Raw transfer]




C2U_A_3(3GUG)
AK1C1_HUMAN
[Raw transfer]




NDP_C_3(1RY8)
AK1C3_HUMAN
[Raw transfer]




NAP_B_7(2IPJ)
AK1C2_HUMAN
[Raw transfer]




NAP_B_2(2F38)
AK1C3_HUMAN
[Raw transfer]




NDP_E_5(1RY8)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(3KRB)
?
[Raw transfer]




NAP_A_2(3UG8)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(4DBW)
AK1C3_HUMAN
[Raw transfer]




NAP_C_3(1XF0)
AK1C3_HUMAN
[Raw transfer]




EDO_A_3(4GAC)
AK1A1_MOUSE
[Raw transfer]




IZP_A_3(3R8G)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(4FAL)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3R8H)
AK1C3_HUMAN
[Raw transfer]




C2U_A_4(3C3U)
AK1C1_HUMAN
[Raw transfer]




16J_A_3(4HMN)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3UGR)
AK1C3_HUMAN
[Raw transfer]




TES_A_4(1AFS)
DIDH_RAT
[Raw transfer]




FFA_B_9(2IPJ)
AK1C2_HUMAN
[Raw transfer]




EDO_A_12(2HDJ)
AK1C2_HUMAN
[Raw transfer]




EDO_A_10(4F40)
PGFS_LEIMA
[Raw transfer]




IMN_A_3(3UGR)
AK1C3_HUMAN
[Raw transfer]




CIT_A_12(1XJB)
AK1C2_HUMAN
[Raw transfer]




10H_A_3(4H7C)
AK1C3_HUMAN
[Raw transfer]




JMS_A_3(3R6I)
AK1C3_HUMAN
[Raw transfer]




15M_C_3(2F38)
AK1C3_HUMAN
[Raw transfer]




P6G_A_3(2FGB)
AK1C3_HUMAN
[Raw transfer]




STR_A_3(1MRQ)
AK1C1_HUMAN
[Raw transfer]




E04_A_3(1ZQ5)
AK1C3_HUMAN
[Raw transfer]




EDO_B_11(2HDJ)
AK1C2_HUMAN
[Raw transfer]




TES_B_8(1J96)
AK1C2_HUMAN
[Raw transfer]




TES_A_6(1J96)
AK1C2_HUMAN
[Raw transfer]




MPD_A_4(1S1P)
AK1C3_HUMAN
[Raw transfer]




EDO_A_4(3R7M)
AK1C3_HUMAN
[Raw transfer]




DMS_A_4(3UGR)
AK1C3_HUMAN
[Raw transfer]




13 PsiBlast_CBE 98.6697%-113 - C8 -2IPJ 12.1 AK1C2_HUMAN
14 PsiBlast_CBE 98.4997%-112 - C8 -2IPJ 12.1 AK1C2_HUMAN
12 PsiBlast_CBE 98.3597%-116 - C8 -1J96 12.1 AK1C2_HUMAN
6 PsiBlast_CBE 97.9997%-113 - C8 -2HDJ 12.1 AK1C2_HUMAN
5 PsiBlast_CBE 97.7997%-112 - C8 -2HDJ 11.6 AK1C2_HUMAN
2 PsiBlast_PDB 97.74100%-112 - C8 -1MRQ 12.6 AK1C1_HUMAN
10 PsiBlast_CBE 97.6697%-114 - C8 -1XJB 12.0 AK1C2_HUMAN
4 PsiBlast_CBE 97.57100%-112 - C8 -3C3U 11.8 AK1C1_HUMAN
9 PsiBlast_CBE 97.5697%-112 - C8 -1XJB 12.1 AK1C2_HUMAN
3 PsiBlast_CBE 97.44100%-113 - C8 -3NTY 11.9 AK1C1_HUMAN
11 PsiBlast_CBE 97.3697%-116 - C8 -1J96 12.6 AK1C2_HUMAN
1 PsiBlast_PDB 97.2099%-116 - C8 -3GUG 12.3 AK1C1_HUMAN
8 PsiBlast_CBE 96.6297%-109 - C8 -1IHI 12.5 AK1C2_HUMAN
7 PsiBlast_CBE 96.3997%-107 - C8 -1IHI 12.3 AK1C2_HUMAN
34 PsiBlast_CBE 94.0087%-110 - C8 -4DBU 11.4 AK1C3_HUMAN
41 PsiBlast_CBE 93.6287%-111 - C8 -1RY8 12.0 AK1C3_HUMAN
42 PsiBlast_CBE 93.6187%-110 - C8 -1RY8 12.6 AK1C3_HUMAN
35 PsiBlast_CBE 93.5487%-111 - C8 -4DBS 11.7 AK1C3_HUMAN
38 PsiBlast_CBE 93.4287%-109 - C8 -2F38 12.5 AK1C3_HUMAN
40 PsiBlast_CBE 93.3187%-113 - C8 -1XF0 11.6 AK1C3_HUMAN
33 PsiBlast_CBE 93.2487%-105 - C8 -4DBU 11.7 AK1C3_HUMAN
31 PsiBlast_CBE 93.0587%-110 - C8 -4DBW 11.9 AK1C3_HUMAN
18 PsiBlast_CBE 92.9987%-109 - C8 -4FAM 12.2 AK1C3_HUMAN
39 PsiBlast_CBE 92.9787%-113 - C8 -1ZQ5 12.3 AK1C3_HUMAN
36 PsiBlast_CBE 92.7887%-111 - C8 -4DBS 11.5 AK1C3_HUMAN
54 HHSearch 92.7288%-111 - C8 -1S1P 12.4 AK1C3_HUMAN
17 PsiBlast_CBE 92.5687%-114 - C8 -4FAM 12.3 AK1C3_HUMAN
32 PsiBlast_CBE 92.2487%-109 - C8 -4DBW 11.9 AK1C3_HUMAN
15 PsiBlast_CBE 92.0187%-108 - C8 -4HMN 11.2 AK1C3_HUMAN
30 PsiBlast_CBE 91.8087%-109 - C8 -3R43 12.0 AK1C3_HUMAN
20 PsiBlast_CBE 91.7987%-110 - C8 -4FA3 12.1 AK1C3_HUMAN
19 PsiBlast_CBE 91.6387%-111 - C8 -4FAL 12.2 AK1C3_HUMAN
37 PsiBlast_CBE 91.6087%-107 - C8 -2FGB 12.2 AK1C3_HUMAN
21 PsiBlast_CBE 91.1687%-111 - C8 -3UGR 12.5 AK1C3_HUMAN
23 PsiBlast_CBE 90.9387%-112 - C8 -3UFY 12.4 AK1C3_HUMAN
29 PsiBlast_CBE 90.8787%-110 - C8 -3R58 12.0 AK1C3_HUMAN
22 PsiBlast_CBE 90.4087%-111 - C8 -3UG8 12.5 AK1C3_HUMAN
27 PsiBlast_CBE 90.2087%-113 - C8 -3R7M 11.9 AK1C3_HUMAN
26 PsiBlast_CBE 90.1187%-112 - C8 -3R8G 12.4 AK1C3_HUMAN
16 PsiBlast_CBE 90.0787%-111 - C8 -4H7C 12.1 AK1C3_HUMAN
24 PsiBlast_CBE 89.9787%-110 - C8 -3R94 12.4 AK1C3_HUMAN
25 PsiBlast_CBE 89.8687%-112 - C8 -3R8H 12.0 AK1C3_HUMAN
28 PsiBlast_CBE 89.6187%-110 - C8 -3R6I 12.3 AK1C3_HUMAN
55 HHSearch 88.8069%-106 - C8 -1AFS 9.1 DIDH_RAT
52 HHSearch 85.1958%-104 - C8 -3BUV 10.5 AK1D1_HUMAN
59 HHSearch 79.8645%-105 - C8 -4GAC 2.8 AK1A1_MOUSE
67 HHSearch 73.5041%-105 - C8 -3H7U 11.5 AKRC9_ARATH
66 HHSearch 72.3837%-107 - C8 -4IJR 9.2 ARA1_YEAST
71 HHSearch 71.8940%-104 - C8 -3H7R 8.8 AKRC8_ARATH
65 HHSearch 71.6836%-104 - C8 -3KRB 12.0 ?
68 HHSearch 69.6842%-103 - C8 -4GIE 13.3 PGFS_TRYCC
70 HHSearch 66.7839%-106 - C8 -4F40 2.5 PGFS_LEIMA