@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00248_AK1C2_: (2014-09-03 )
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Atome Classification :

(69 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

0HV_B_7(4DBS)
AK1C3_HUMAN
[Raw transfer]




0SL_A_3(4FA3)
AK1C3_HUMAN
[Raw transfer]




RUT_D_4(1RY8)
AK1C3_HUMAN
[Raw transfer]




IMN_A_3(3UG8)
AK1C3_HUMAN
[Raw transfer]




FLR_A_3(3R94)
AK1C3_HUMAN
[Raw transfer]




NPS_A_3(3R58)
AK1C3_HUMAN
[Raw transfer]




0SZ_A_4(4FAM)
AK1C3_HUMAN
[Raw transfer]




RUT_F_6(1RY8)
AK1C3_HUMAN
[Raw transfer]




NPX_A_3(3UFY)
AK1C3_HUMAN
[Raw transfer]




ID8_A_3(3R43)
AK1C3_HUMAN
[Raw transfer]




ZOM_A_3(3R8H)
AK1C3_HUMAN
[Raw transfer]




511_A_4(4DBW)
AK1C3_HUMAN
[Raw transfer]




0SZ_B_12(4FAM)
AK1C3_HUMAN
[Raw transfer]




511_B_7(4DBW)
AK1C3_HUMAN
[Raw transfer]




0T0_A_3(4FAL)
AK1C3_HUMAN
[Raw transfer]




BT9_B_6(4DBU)
AK1C3_HUMAN
[Raw transfer]




BT9_A_4(4DBU)
AK1C3_HUMAN
[Raw transfer]




NAP_B_5(4DBU)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(4DBU)
AK1C3_HUMAN
[Raw transfer]




IU5_E_5(1IHI)
AK1C2_HUMAN
[Raw transfer]




NAP_A_5(1J96)
AK1C2_HUMAN
[Raw transfer]




NDP_A_7(2HDJ)
AK1C2_HUMAN
[Raw transfer]




5P3_A_3(3NTY)
AK1C1_HUMAN
[Raw transfer]




NAP_A_8(1XJB)
AK1C2_HUMAN
[Raw transfer]




NAP_A_2(3GUG)
AK1C1_HUMAN
[Raw transfer]




NAP_A_3(3C3U)
AK1C1_HUMAN
[Raw transfer]




NAP_B_7(1J96)
AK1C2_HUMAN
[Raw transfer]




SUZ_A_3(3R7M)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(1MRQ)
AK1C1_HUMAN
[Raw transfer]




NAP_A_2(3NTY)
AK1C1_HUMAN
[Raw transfer]




NAP_A_3(3CV6)
AK1CL_MOUSE
[Raw transfer]




NAP_A_3(4GIE)
PGFS_TRYCC
[Raw transfer]




NAP_B_6(1Q5M)
PE2R_RABIT
[Raw transfer]




NAP_B_6(4DBS)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(4DBS)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(4DZ5)
AK1C3_HUMAN
[Raw transfer]




NAP_E_5(1Q13)
PE2R_RABIT
[Raw transfer]




NAP_B_6(2FVL)
AK1C4_HUMAN
[Raw transfer]




NAP_A_2(4FA3)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3UFY)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3H7U)
AKRC9_ARATH
[Raw transfer]




NAP_A_2(3R8G)
AK1C3_HUMAN
[Raw transfer]




NAP_B_6(4DBW)
AK1C3_HUMAN
[Raw transfer]




NAP_D_4(1Q13)
PE2R_RABIT
[Raw transfer]




NAP_B_7(3CV6)
AK1CL_MOUSE
[Raw transfer]




NAP_A_3(1AFS)
DIDH_RAT
[Raw transfer]




NAP_A_2(3H7R)
AKRC8_ARATH
[Raw transfer]




0HV_A_4(4DBS)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(1S2C)
AK1C3_HUMAN
[Raw transfer]




NAP_A_4(3BUV)
AK1D1_HUMAN
[Raw transfer]




NAP_A_2(4H7C)
AK1C3_HUMAN
[Raw transfer]




C2U_A_3(3GUG)
AK1C1_HUMAN
[Raw transfer]




NAP_A_3(1S1R)
AK1C3_HUMAN
[Raw transfer]




NAP_A_4(2FVL)
AK1C4_HUMAN
[Raw transfer]




NAP_A_2(3R43)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(4FAM)
AK1C3_HUMAN
[Raw transfer]




NAP_A_4(1ZQ5)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(4HMN)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(2P5N)
AK1CL_MOUSE
[Raw transfer]




NAP_B_4(2P5N)
AK1CL_MOUSE
[Raw transfer]




NAP_A_4(2FGB)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(1S1P)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3R58)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3R6I)
AK1C3_HUMAN
[Raw transfer]




NAP_B_11(4FAM)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3R94)
AK1C3_HUMAN
[Raw transfer]




NAP_A_5(1Q5M)
PE2R_RABIT
[Raw transfer]




IU5_F_6(1IHI)
AK1C2_HUMAN
[Raw transfer]




NAP_A_2(3R7M)
AK1C3_HUMAN
[Raw transfer]




NAP_A_6(2IPJ)
AK1C2_HUMAN
[Raw transfer]




PG2_F_6(1RY0)
AK1C3_HUMAN
[Raw transfer]




NAP_D_4(1IHI)
AK1C2_HUMAN
[Raw transfer]




IZP_A_3(3R8G)
AK1C3_HUMAN
[Raw transfer]




NAP_B_9(1XJB)
AK1C2_HUMAN
[Raw transfer]




NDP_A_3(4IJR)
ARA1_YEAST
[Raw transfer]




NDP_B_8(2HDJ)
AK1C2_HUMAN
[Raw transfer]




FFA_A_8(2IPJ)
AK1C2_HUMAN
[Raw transfer]




NAP_C_3(1IHI)
AK1C2_HUMAN
[Raw transfer]




NAP_E_5(1RY0)
AK1C3_HUMAN
[Raw transfer]




NAP_C_3(1RY0)
AK1C3_HUMAN
[Raw transfer]




NDP_E_5(1RY8)
AK1C3_HUMAN
[Raw transfer]




NAP_B_7(2IPJ)
AK1C2_HUMAN
[Raw transfer]




NAP_A_3(3KRB)
?
[Raw transfer]




NAP_A_2(4FAL)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3R8H)
AK1C3_HUMAN
[Raw transfer]




NAP_B_2(2F38)
AK1C3_HUMAN
[Raw transfer]




NAP_C_3(1XF0)
AK1C3_HUMAN
[Raw transfer]




FLF_A_3(1S2C)
AK1C3_HUMAN
[Raw transfer]




NDP_C_3(1RY8)
AK1C3_HUMAN
[Raw transfer]




C2U_A_4(3C3U)
AK1C1_HUMAN
[Raw transfer]




NAP_A_3(4DBW)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3UG8)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(1S2A)
AK1C3_HUMAN
[Raw transfer]




PG2_D_4(1RY0)
AK1C3_HUMAN
[Raw transfer]




NAP_C_5(2FVL)
AK1C4_HUMAN
[Raw transfer]




EDO_A_3(4GAC)
AK1A1_MOUSE
[Raw transfer]




16J_A_3(4HMN)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3UGR)
AK1C3_HUMAN
[Raw transfer]




FFA_B_9(2IPJ)
AK1C2_HUMAN
[Raw transfer]




MPD_A_5(2P5N)
AK1CL_MOUSE
[Raw transfer]




HXS_B_8(3CV6)
AK1CL_MOUSE
[Raw transfer]




HXS_A_4(3CV6)
AK1CL_MOUSE
[Raw transfer]




IMN_A_3(1S2A)
AK1C3_HUMAN
[Raw transfer]




JMS_A_3(3R6I)
AK1C3_HUMAN
[Raw transfer]




EDO_A_10(4F40)
PGFS_LEIMA
[Raw transfer]




MPD_B_6(2P5N)
AK1CL_MOUSE
[Raw transfer]




IMN_A_3(3UGR)
AK1C3_HUMAN
[Raw transfer]




TES_F_6(1Q13)
PE2R_RABIT
[Raw transfer]




EDO_A_12(2HDJ)
AK1C2_HUMAN
[Raw transfer]




10H_A_3(4H7C)
AK1C3_HUMAN
[Raw transfer]




CIT_A_12(1XJB)
AK1C2_HUMAN
[Raw transfer]




15M_C_3(2F38)
AK1C3_HUMAN
[Raw transfer]




P6G_A_3(2FGB)
AK1C3_HUMAN
[Raw transfer]




STR_A_3(1MRQ)
AK1C1_HUMAN
[Raw transfer]




E04_A_3(1ZQ5)
AK1C3_HUMAN
[Raw transfer]




EDO_A_7(3UFY)
AK1C3_HUMAN
[Raw transfer]




EDO_A_5(3R58)
AK1C3_HUMAN
[Raw transfer]




TES_A_6(1J96)
AK1C2_HUMAN
[Raw transfer]




TES_B_8(1J96)
AK1C2_HUMAN
[Raw transfer]




MPD_A_4(1S1P)
AK1C3_HUMAN
[Raw transfer]




EDO_A_4(3R7M)
AK1C3_HUMAN
[Raw transfer]




MPD_A_4(1S1R)
AK1C3_HUMAN
[Raw transfer]




PG4_A_6(4DZ5)
AK1C3_HUMAN
[Raw transfer]




DMS_A_4(1S2A)
AK1C3_HUMAN
[Raw transfer]




DMS_A_4(3UGR)
AK1C3_HUMAN
[Raw transfer]




3 PsiBlast_PDB 99.3099%-114 - C6 -2IPJ 12.1 AK1C2_HUMAN
2 PsiBlast_PDB 99.23100%-119 - C6 -1J96 12.1 AK1C2_HUMAN
27 PsiBlast_CBE 99.1099%-115 - C6 -2IPJ 12.1 AK1C2_HUMAN
22 PsiBlast_CBE 98.85100%-115 - C6 -2HDJ 12.1 AK1C2_HUMAN
1 PsiBlast_PDB 98.71100%-117 - C6 -1XJB 12.0 AK1C2_HUMAN
21 PsiBlast_CBE 98.69100%-115 - C6 -2HDJ 11.6 AK1C2_HUMAN
25 PsiBlast_CBE 98.54100%-114 - C6 -1XJB 12.1 AK1C2_HUMAN
26 PsiBlast_CBE 98.11100%-119 - C6 -1J96 12.6 AK1C2_HUMAN
24 PsiBlast_CBE 97.39100%-111 - C6 -1IHI 12.5 AK1C2_HUMAN
23 PsiBlast_CBE 97.21100%-110 - C6 -1IHI 12.3 AK1C2_HUMAN
29 PsiBlast_CBE 97.2097%-114 - C6 -3C3U 11.8 AK1C1_HUMAN
5 PsiBlast_PDB 97.1097%-113 - C6 -1MRQ 12.6 AK1C1_HUMAN
28 PsiBlast_CBE 96.5397%-114 - C6 -3NTY 11.9 AK1C1_HUMAN
4 PsiBlast_PDB 96.2697%-118 - C6 -3GUG 12.3 AK1C1_HUMAN
7 PsiBlast_PDB 94.1086%-113 - C6 -1RY8 12.6 AK1C3_HUMAN
46 PsiBlast_CBE 94.0886%-115 - C6 -4DBS 11.7 AK1C3_HUMAN
9 PsiBlast_PDB 93.9786%-112 - C6 -2F38 12.5 AK1C3_HUMAN
44 PsiBlast_CBE 93.8486%-114 - C6 -4DBW 11.9 AK1C3_HUMAN
13 PsiBlast_PDB 93.8286%-114 - C6 -4DBU 11.0 AK1C3_HUMAN
45 PsiBlast_CBE 93.7986%-109 - C6 -4DBU 11.7 AK1C3_HUMAN
42 PsiBlast_CBE 93.7786%-114 - C6 -1S1R 11.9 AK1C3_HUMAN
47 PsiBlast_CBE 93.7286%-114 - C6 -1RY8 12.0 AK1C3_HUMAN
48 PsiBlast_CBE 93.6286%-115 - C6 -1RY0 12.0 AK1C3_HUMAN
8 PsiBlast_PDB 93.5086%-116 - C6 -1XF0 11.6 AK1C3_HUMAN
12 PsiBlast_PDB 93.1886%-114 - C6 -4DBS 11.8 AK1C3_HUMAN
6 PsiBlast_PDB 93.1086%-114 - C6 -1RY0 12.7 AK1C3_HUMAN
33 PsiBlast_CBE 92.9086%-111 - C6 -4FAM 12.2 AK1C3_HUMAN
10 PsiBlast_PDB 92.8486%-115 - C6 -1ZQ5 12.3 AK1C3_HUMAN
52 PsiBlast_CBE 92.7781%-113 - C6 -2FVL 12.5 AK1C4_HUMAN
50 PsiBlast_CBE 92.7481%-111 - C6 -2FVL 11.9 AK1C4_HUMAN
75 HHSearch 92.6887%-114 - C6 -1S1P 12.4 AK1C3_HUMAN
41 PsiBlast_CBE 92.6486%-114 - C6 -1S2A 12.5 AK1C3_HUMAN
14 PsiBlast_PDB 92.6186%-111 - C6 -4DBW 11.9 AK1C3_HUMAN
51 PsiBlast_CBE 92.5481%-111 - C6 -2FVL 11.0 AK1C4_HUMAN
40 PsiBlast_CBE 92.5486%-114 - C6 -1S2C 12.1 AK1C3_HUMAN
58 PsiBlast_CBE 92.5273%-109 - C6 -3CV6 9.7 AK1CL_MOUSE
32 PsiBlast_CBE 92.3986%-116 - C6 -4FAM 12.3 AK1C3_HUMAN
54 PsiBlast_CBE 92.3378%-109 - C6 -1Q13 11.7 PE2R_RABIT
56 PsiBlast_CBE 92.2478%-111 - C6 -1Q5M 12.4 PE2R_RABIT
57 PsiBlast_CBE 92.1673%-110 - C6 -3CV6 9.9 AK1CL_MOUSE
35 PsiBlast_CBE 92.1386%-113 - C6 -4FA3 12.1 AK1C3_HUMAN
55 PsiBlast_CBE 92.0778%-109 - C6 -1Q5M 12.2 PE2R_RABIT
61 PsiBlast_CBE 91.8373%-111 - C6 -2P5N 10.4 AK1CL_MOUSE
11 PsiBlast_PDB 91.7886%-111 - C6 -2FGB 12.2 AK1C3_HUMAN
53 PsiBlast_CBE 91.6978%-109 - C6 -1Q13 10.9 PE2R_RABIT
15 PsiBlast_PDB 91.6286%-112 - C6 -3R43 12.0 AK1C3_HUMAN
30 PsiBlast_CBE 91.4486%-111 - C6 -4HMN 11.2 AK1C3_HUMAN
62 PsiBlast_CBE 91.3273%-112 - C6 -2P5N 5.6 AK1CL_MOUSE
34 PsiBlast_CBE 91.0686%-114 - C6 -4FAL 12.2 AK1C3_HUMAN
36 PsiBlast_CBE 91.0486%-115 - C6 -3UGR 12.5 AK1C3_HUMAN
16 PsiBlast_PDB 90.9086%-114 - C6 -3R58 12.0 AK1C3_HUMAN
38 PsiBlast_CBE 90.8186%-116 - C6 -3UFY 12.4 AK1C3_HUMAN
37 PsiBlast_CBE 90.5086%-115 - C6 -3UG8 12.5 AK1C3_HUMAN
18 PsiBlast_PDB 89.9586%-117 - C6 -3R7M 11.9 AK1C3_HUMAN
49 PsiBlast_CBE 89.9286%-112 - C6 -4DZ5 12.4 AK1C3_HUMAN
20 PsiBlast_PDB 89.7986%-116 - C6 -3R8H 12.0 AK1C3_HUMAN
19 PsiBlast_PDB 89.7786%-116 - C6 -3R8G 12.4 AK1C3_HUMAN
39 PsiBlast_CBE 89.6386%-114 - C6 -3R94 12.4 AK1C3_HUMAN
31 PsiBlast_CBE 89.5586%-116 - C6 -4H7C 12.1 AK1C3_HUMAN
17 PsiBlast_PDB 89.5186%-114 - C6 -3R6I 12.3 AK1C3_HUMAN
76 HHSearch 89.5069%-109 - C6 -1AFS 9.1 DIDH_RAT
73 HHSearch 85.5657%-108 - C6 -3BUV 10.5 AK1D1_HUMAN
80 HHSearch 81.8345%-109 - C6 -4GAC 2.8 AK1A1_MOUSE
88 HHSearch 74.6241%-109 - C6 -3H7U 11.4 AKRC9_ARATH
87 HHSearch 73.6937%-111 - C6 -4IJR 9.2 ARA1_YEAST
92 HHSearch 73.6640%-107 - C6 -3H7R 8.6 AKRC8_ARATH
86 HHSearch 72.9437%-107 - C6 -3KRB 12.0 ?
89 HHSearch 70.3842%-109 - C6 -4GIE 13.3 PGFS_TRYCC
91 HHSearch 68.4139%-111 - C6 -4F40 2.5 PGFS_LEIMA