@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00248_AK1C3_: (2014-09-03 )
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY

Atome Classification :

(68 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

RUT_D_4(1RY8)
AK1C3_HUMAN
[Raw transfer]




RUT_F_6(1RY8)
AK1C3_HUMAN
[Raw transfer]




FLF_A_3(1S2C)
AK1C3_HUMAN
[Raw transfer]




ID8_A_3(3R43)
AK1C3_HUMAN
[Raw transfer]




FLR_A_3(3R94)
AK1C3_HUMAN
[Raw transfer]




IU5_E_5(1IHI)
AK1C2_HUMAN
[Raw transfer]




IMN_A_3(3UG8)
AK1C3_HUMAN
[Raw transfer]




NPS_A_3(3R58)
AK1C3_HUMAN
[Raw transfer]




BT9_A_4(4DBU)
AK1C3_HUMAN
[Raw transfer]




ZOM_A_3(3R8H)
AK1C3_HUMAN
[Raw transfer]




0SL_A_3(4FA3)
AK1C3_HUMAN
[Raw transfer]




NPX_A_3(3UFY)
AK1C3_HUMAN
[Raw transfer]




IU5_F_6(1IHI)
AK1C2_HUMAN
[Raw transfer]




SUZ_A_3(3R7M)
AK1C3_HUMAN
[Raw transfer]




511_B_7(4DBW)
AK1C3_HUMAN
[Raw transfer]




PG2_F_6(1RY0)
AK1C3_HUMAN
[Raw transfer]




0SZ_B_12(4FAM)
AK1C3_HUMAN
[Raw transfer]




511_A_4(4DBW)
AK1C3_HUMAN
[Raw transfer]




BT9_B_6(4DBU)
AK1C3_HUMAN
[Raw transfer]




0T0_A_3(4FAL)
AK1C3_HUMAN
[Raw transfer]




5P3_A_3(3NTY)
AK1C1_HUMAN
[Raw transfer]




NAP_A_2(4HMN)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(4FA3)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(4GIE)
PGFS_TRYCC
[Raw transfer]




NAP_A_2(3R58)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3R8G)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(1S1P)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(4DBU)
AK1C3_HUMAN
[Raw transfer]




16J_A_3(4HMN)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(4DZ5)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3NTY)
AK1C1_HUMAN
[Raw transfer]




NAP_A_3(4FAM)
AK1C3_HUMAN
[Raw transfer]




NAP_B_5(4DBU)
AK1C3_HUMAN
[Raw transfer]




NAP_C_3(1XF0)
AK1C3_HUMAN
[Raw transfer]




NAP_B_11(4FAM)
AK1C3_HUMAN
[Raw transfer]




0SZ_A_4(4FAM)
AK1C3_HUMAN
[Raw transfer]




NAP_E_5(1Q13)
PE2R_RABIT
[Raw transfer]




NAP_A_4(1ZQ5)
AK1C3_HUMAN
[Raw transfer]




NAP_A_4(2FGB)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3R43)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(1S1R)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(4DBS)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3UFY)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(4DBW)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(4H7C)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3R6I)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(1AFS)
DIDH_RAT
[Raw transfer]




NAP_A_2(4FAL)
AK1C3_HUMAN
[Raw transfer]




NAP_D_4(1Q13)
PE2R_RABIT
[Raw transfer]




NAP_A_2(3R7M)
AK1C3_HUMAN
[Raw transfer]




NAP_B_6(4DBW)
AK1C3_HUMAN
[Raw transfer]




NAP_B_6(4DBS)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(1S2C)
AK1C3_HUMAN
[Raw transfer]




IZP_A_3(3R8G)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3R94)
AK1C3_HUMAN
[Raw transfer]




C2U_A_4(3C3U)
AK1C1_HUMAN
[Raw transfer]




C2U_A_3(3GUG)
AK1C1_HUMAN
[Raw transfer]




JMS_A_3(3R6I)
AK1C3_HUMAN
[Raw transfer]




FFA_A_8(2IPJ)
AK1C2_HUMAN
[Raw transfer]




NAP_A_2(3H7R)
AKRC8_ARATH
[Raw transfer]




NAP_B_6(1Q5M)
PE2R_RABIT
[Raw transfer]




NAP_A_5(1Q5M)
PE2R_RABIT
[Raw transfer]




NAP_B_6(2FVL)
AK1C4_HUMAN
[Raw transfer]




0HV_A_4(4DBS)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(3C3U)
AK1C1_HUMAN
[Raw transfer]




0HV_B_7(4DBS)
AK1C3_HUMAN
[Raw transfer]




NAP_A_3(2P5N)
AK1CL_MOUSE
[Raw transfer]




NAP_A_2(3H7U)
AKRC9_ARATH
[Raw transfer]




NAP_A_4(2FVL)
AK1C4_HUMAN
[Raw transfer]




NDP_B_4(2HEJ)
AK1CL_MOUSE
[Raw transfer]




PG2_D_4(1RY0)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3GUG)
AK1C1_HUMAN
[Raw transfer]




NDP_A_3(2HEJ)
AK1CL_MOUSE
[Raw transfer]




NAP_B_4(2P5N)
AK1CL_MOUSE
[Raw transfer]




NAP_A_2(3UG8)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(1MRQ)
AK1C1_HUMAN
[Raw transfer]




NAP_A_4(3BUV)
AK1D1_HUMAN
[Raw transfer]




NDP_A_7(2HDJ)
AK1C2_HUMAN
[Raw transfer]




NAP_A_2(3R8H)
AK1C3_HUMAN
[Raw transfer]




NAP_A_8(1XJB)
AK1C2_HUMAN
[Raw transfer]




NAP_A_5(1J96)
AK1C2_HUMAN
[Raw transfer]




NAP_B_7(1J96)
AK1C2_HUMAN
[Raw transfer]




NDP_A_3(4IJR)
ARA1_YEAST
[Raw transfer]




10H_A_3(4H7C)
AK1C3_HUMAN
[Raw transfer]




NAP_B_7(2IPJ)
AK1C2_HUMAN
[Raw transfer]




MPD_B_6(2P5N)
AK1CL_MOUSE
[Raw transfer]




MPD_A_5(2P5N)
AK1CL_MOUSE
[Raw transfer]




TES_A_4(1AFS)
DIDH_RAT
[Raw transfer]




NAP_C_3(1IHI)
AK1C2_HUMAN
[Raw transfer]




NAP_B_2(2F38)
AK1C3_HUMAN
[Raw transfer]




NAP_D_4(1IHI)
AK1C2_HUMAN
[Raw transfer]




NAP_C_5(2FVL)
AK1C4_HUMAN
[Raw transfer]




NAP_B_9(1XJB)
AK1C2_HUMAN
[Raw transfer]




NAP_E_5(1RY0)
AK1C3_HUMAN
[Raw transfer]




NAP_C_3(1RY0)
AK1C3_HUMAN
[Raw transfer]




NAP_A_6(2IPJ)
AK1C2_HUMAN
[Raw transfer]




NDP_E_5(1RY8)
AK1C3_HUMAN
[Raw transfer]




NDP_C_3(1RY8)
AK1C3_HUMAN
[Raw transfer]




NAP_A_2(3UGR)
AK1C3_HUMAN
[Raw transfer]




FFA_B_9(2IPJ)
AK1C2_HUMAN
[Raw transfer]




NDP_B_8(2HDJ)
AK1C2_HUMAN
[Raw transfer]




NAP_A_2(1S2A)
AK1C3_HUMAN
[Raw transfer]




TES_F_6(1Q13)
PE2R_RABIT
[Raw transfer]




E04_A_3(1ZQ5)
AK1C3_HUMAN
[Raw transfer]




15M_C_3(2F38)
AK1C3_HUMAN
[Raw transfer]




IMN_A_3(1S2A)
AK1C3_HUMAN
[Raw transfer]




IMN_A_3(3UGR)
AK1C3_HUMAN
[Raw transfer]




EDO_A_3(4GAC)
AK1A1_MOUSE
[Raw transfer]




CIT_A_12(1XJB)
AK1C2_HUMAN
[Raw transfer]




EDO_A_10(4F40)
PGFS_LEIMA
[Raw transfer]




EDO_A_12(2HDJ)
AK1C2_HUMAN
[Raw transfer]




EDO_B_11(2HDJ)
AK1C2_HUMAN
[Raw transfer]




TES_B_8(1J96)
AK1C2_HUMAN
[Raw transfer]




STR_A_3(1MRQ)
AK1C1_HUMAN
[Raw transfer]




P6G_A_3(2FGB)
AK1C3_HUMAN
[Raw transfer]




TES_A_6(1J96)
AK1C2_HUMAN
[Raw transfer]




MPD_A_4(1S1R)
AK1C3_HUMAN
[Raw transfer]




PG4_A_6(4DZ5)
AK1C3_HUMAN
[Raw transfer]




MPD_A_4(1S1P)
AK1C3_HUMAN
[Raw transfer]




EDO_A_5(2HEJ)
AK1CL_MOUSE
[Raw transfer]




EDO_B_6(2HEJ)
AK1CL_MOUSE
[Raw transfer]




DMS_A_5(1S2C)
AK1C3_HUMAN
[Raw transfer]




EDO_A_4(3R7M)
AK1C3_HUMAN
[Raw transfer]




DMS_A_4(3UGR)
AK1C3_HUMAN
[Raw transfer]




DMS_A_4(1S2A)
AK1C3_HUMAN
[Raw transfer]




20 PsiBlast_PDB 95.7299%-108 - C8 -1ZQ5 12.9 AK1C3_HUMAN
12 PsiBlast_PDB 95.72100%-111 - C8 -4FAL 12.6 AK1C3_HUMAN
1 PsiBlast_PDB 95.71100%-106 - C8 -3R43 12.4 AK1C3_HUMAN
33 PsiBlast_CBE 95.5999%-107 - C8 -1S1R 12.5 AK1C3_HUMAN
48 PsiBlast_CBE 95.5786%-105 - C8 -2IPJ 12.2 AK1C2_HUMAN
28 PsiBlast_CBE 95.4299%-106 - C8 -2FGB 12.8 AK1C3_HUMAN
49 PsiBlast_CBE 95.2486%-104 - C8 -2IPJ 12.1 AK1C2_HUMAN
47 PsiBlast_CBE 95.2086%-108 - C8 -1J96 12.5 AK1C2_HUMAN
15 PsiBlast_PDB 95.17100%-108 - C8 -4HMN 12.0 AK1C3_HUMAN
11 PsiBlast_PDB 95.09100%-112 - C8 -4FA3 12.4 AK1C3_HUMAN
2 PsiBlast_PDB 95.09100%-110 - C8 -3R58 12.5 AK1C3_HUMAN
29 PsiBlast_CBE 95.0299%-107 - C8 -1RY8 12.8 AK1C3_HUMAN
8 PsiBlast_PDB 95.02100%-113 - C8 -3UFY 12.6 AK1C3_HUMAN
30 PsiBlast_CBE 94.9999%-108 - C8 -1RY0 12.5 AK1C3_HUMAN
32 PsiBlast_CBE 94.9799%-108 - C8 -1S2A 12.8 AK1C3_HUMAN
44 PsiBlast_CBE 94.9486%-104 - C8 -1XJB 12.2 AK1C2_HUMAN
22 PsiBlast_CBE 94.9399%-108 - C8 -4DBW 12.7 AK1C3_HUMAN
40 PsiBlast_CBE 94.8186%-104 - C8 -2HDJ 11.7 AK1C2_HUMAN
75 HHSearch 94.76100%-107 - C8 -1S1P 12.9 AK1C3_HUMAN
16 PsiBlast_PDB 94.7599%-108 - C8 -1RY0 13.2 AK1C3_HUMAN
24 PsiBlast_CBE 94.7399%-103 - C8 -4DBU 12.0 AK1C3_HUMAN
45 PsiBlast_CBE 94.7086%-106 - C8 -1XJB 11.8 AK1C2_HUMAN
35 PsiBlast_CBE 94.7099%-109 - C8 -4DZ5 12.8 AK1C3_HUMAN
17 PsiBlast_PDB 94.6799%-106 - C8 -1RY8 12.9 AK1C3_HUMAN
10 PsiBlast_PDB 94.63100%-111 - C8 -3UGR 12.9 AK1C3_HUMAN
31 PsiBlast_CBE 94.6199%-108 - C8 -1S2C 12.7 AK1C3_HUMAN
9 PsiBlast_PDB 94.60100%-111 - C8 -3UG8 12.9 AK1C3_HUMAN
26 PsiBlast_CBE 94.4999%-107 - C8 -4DBS 12.5 AK1C3_HUMAN
19 PsiBlast_PDB 94.4799%-105 - C8 -2F38 12.7 AK1C3_HUMAN
13 PsiBlast_PDB 94.45100%-107 - C8 -4FAM 12.8 AK1C3_HUMAN
41 PsiBlast_CBE 94.4286%-104 - C8 -2HDJ 12.1 AK1C2_HUMAN
18 PsiBlast_PDB 94.3699%-107 - C8 -1XF0 12.4 AK1C3_HUMAN
39 PsiBlast_CBE 94.3487%-103 - C8 -1MRQ 12.9 AK1C1_HUMAN
5 PsiBlast_PDB 94.27100%-112 - C8 -3R8G 12.7 AK1C3_HUMAN
38 PsiBlast_CBE 94.2287%-103 - C8 -3C3U 12.0 AK1C1_HUMAN
21 PsiBlast_CBE 94.22100%-110 - C8 -4FAM 13.1 AK1C3_HUMAN
25 PsiBlast_CBE 94.2199%-109 - C8 -4DBU 11.6 AK1C3_HUMAN
27 PsiBlast_CBE 94.1999%-108 - C8 -4DBS 12.7 AK1C3_HUMAN
14 PsiBlast_PDB 94.12100%-111 - C8 -4H7C 12.7 AK1C3_HUMAN
46 PsiBlast_CBE 94.0786%-107 - C8 -1J96 12.9 AK1C2_HUMAN
4 PsiBlast_PDB 94.05100%-113 - C8 -3R7M 12.3 AK1C3_HUMAN
3 PsiBlast_PDB 94.04100%-110 - C8 -3R6I 12.6 AK1C3_HUMAN
36 PsiBlast_CBE 93.8287%-107 - C8 -3GUG 11.5 AK1C1_HUMAN
7 PsiBlast_PDB 93.80100%-111 - C8 -3R94 12.7 AK1C3_HUMAN
23 PsiBlast_CBE 93.7699%-105 - C8 -4DBW 12.7 AK1C3_HUMAN
37 PsiBlast_CBE 93.6787%-105 - C8 -3NTY 12.2 AK1C1_HUMAN
43 PsiBlast_CBE 93.5086%-100 - C8 -1IHI 11.7 AK1C2_HUMAN
52 PsiBlast_CBE 93.4184%-104 - C8 -2FVL 12.5 AK1C4_HUMAN
6 PsiBlast_PDB 93.40100%-113 - C8 -3R8H 12.6 AK1C3_HUMAN
42 PsiBlast_CBE 93.0386% -99 - C8 -1IHI 11.5 AK1C2_HUMAN
50 PsiBlast_CBE 92.9384%-102 - C8 -2FVL 12.1 AK1C4_HUMAN
56 PsiBlast_CBE 92.6477%-102 - C8 -1Q5M 11.8 PE2R_RABIT
51 PsiBlast_CBE 92.6284%-103 - C8 -2FVL 12.3 AK1C4_HUMAN
54 PsiBlast_CBE 92.4377%-100 - C8 -1Q13 10.9 PE2R_RABIT
55 PsiBlast_CBE 92.3877%-100 - C8 -1Q5M 11.5 PE2R_RABIT
53 PsiBlast_CBE 91.2377%-101 - C8 -1Q13 9.7 PE2R_RABIT
59 PsiBlast_CBE 89.9472%-103 - C8 -2P5N 9.9 AK1CL_MOUSE
60 PsiBlast_CBE 89.3572%-102 - C8 -2P5N 5.4 AK1CL_MOUSE
76 HHSearch 88.9070% -99 - C8 -1AFS 11.2 DIDH_RAT
61 PsiBlast_CBE 88.9072%-103 - C8 -2HEJ 10.2 AK1CL_MOUSE
62 PsiBlast_CBE 88.6472%-102 - C8 -2HEJ 10.2 AK1CL_MOUSE
73 HHSearch 83.4255% -99 - C8 -3BUV 12.8 AK1D1_HUMAN
80 HHSearch 78.3043%-101 - C8 -4GAC 2.7 AK1A1_MOUSE
88 HHSearch 73.5740% -99 - C8 -3H7U 12.1 AKRC9_ARATH
92 HHSearch 71.9941% -98 - C8 -3H7R 10.0 AKRC8_ARATH
87 HHSearch 70.5234% -99 - C8 -4IJR 9.2 ARA1_YEAST
89 HHSearch 68.7438%-100 - C8 -4GIE 13.2 PGFS_TRYCC
90 HHSearch 68.1339%-101 - C8 -4F40 2.4 PGFS_LEIMA