@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00248_ALDR_B: (2014-09-03 )
AHNIVLYTGAKMPILGLGTWKSPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLALQAKLQEQVVKREDLFIVSKLWCTYHDKDLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKDFFPLDEDGNVIPSEKDFVDTWTAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKPAVNQIECHPYLTQEKLIQYCNSKGIVVTAYSPLGSPDRPWAKPEDPSILEDPRIKAIADKYNKTTAQVLIRFPIQRNLIVIPKSVTPERIAENFQVFDFELDKEDMNTLLSYNRDWRACALVSCASHRDYPFHEEF

Atome Classification :

(66 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

0PY_A_4(3V36)
ALDR_HUMAN
[Raw transfer]




3T4_A_3(3T42)
ALDR_HUMAN
[Raw transfer]




ZST_A_3(2HVN)
ALDR_HUMAN
[Raw transfer]




393_A_3(2PZN)
ALDR_HUMAN
[Raw transfer]




393_A_3(2IKJ)
ALDR_HUMAN
[Raw transfer]




Q74_A_3(3G5E)
ALDR_HUMAN
[Raw transfer]




ITA_A_3(2NVC)
ALDR_HUMAN
[Raw transfer]




ID5_A_3(1T41)
ALDR_HUMAN
[Raw transfer]




53N_A_3(3DN5)
ALDR_HUMAN
[Raw transfer]




3NA_A_3(1Z3N)
ALDR_HUMAN
[Raw transfer]




ITB_A_3(2NVD)
ALDR_HUMAN
[Raw transfer]




ZST_A_3(2DUX)
ALDR_HUMAN
[Raw transfer]




2X9_A_3(4GCA)
ALDR_HUMAN
[Raw transfer]




LDT_A_3(3GHU)
ALDR_HUMAN
[Raw transfer]




47D_A_3(2PDG)
ALDR_HUMAN
[Raw transfer]




LIT_A_3(2IKH)
ALDR_HUMAN
[Raw transfer]




DOY_A_3(3P2V)
ALDR_HUMAN
[Raw transfer]




388_A_3(2IKI)
ALDR_HUMAN
[Raw transfer]




ZST_A_3(2DUZ)
ALDR_HUMAN
[Raw transfer]




LDT_A_3(3GHS)
ALDR_HUMAN
[Raw transfer]




BTO_A_3(2IKG)
ALDR_HUMAN
[Raw transfer]




LDT_A_3(3GHR)
ALDR_HUMAN
[Raw transfer]




LDT_A_3(3GHT)
ALDR_HUMAN
[Raw transfer]




ZST_A_3(3LEN)
ALDR_HUMAN
[Raw transfer]




ZST_A_3(2HV5)
ALDR_HUMAN
[Raw transfer]




LDT_A_3(2QXW)
ALDR_HUMAN
[Raw transfer]




ZST_A_3(2FZ9)
ALDR_HUMAN
[Raw transfer]




SBI_A_3(2PDK)
ALDR_HUMAN
[Raw transfer]




ZST_A_3(2HVO)
ALDR_HUMAN
[Raw transfer]




BFI_A_2(1PWL)
ALDR_HUMAN
[Raw transfer]




ZST_A_3(2FZ8)
ALDR_HUMAN
[Raw transfer]




NDP_A_3(4IJR)
ARA1_YEAST
[Raw transfer]




NAP_A_3(3Q65)
ALDR_HUMAN
[Raw transfer]




NDP_A_2(2QXW)
ALDR_HUMAN
[Raw transfer]




NDP_A_2(3GHT)
ALDR_HUMAN
[Raw transfer]




TLT_A_3(3S3G)
ALDR_HUMAN
[Raw transfer]




NAP_B_10(3Q65)
ALDR_HUMAN
[Raw transfer]




TOL_A_3(2FZD)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2HV5)
ALDR_HUMAN
[Raw transfer]




NDP_A_2(1Z3N)
ALDR_HUMAN
[Raw transfer]




ZST_A_3(2PD5)
ALDR_HUMAN
[Raw transfer]




NDP_A_2(3G5E)
ALDR_HUMAN
[Raw transfer]




3GR_A_3(3V36)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2PD9)
ALDR_HUMAN
[Raw transfer]




LDT_A_4(2PEV)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2FZD)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2J8T)
ALDR_HUMAN
[Raw transfer]




NDP_A_2(3GHR)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2HVO)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3V36)
ALDR_HUMAN
[Raw transfer]




NDP_A_2(3GHS)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2PDG)
ALDR_HUMAN
[Raw transfer]




NAP_A_3(1PWM)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3T42)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(1X96)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2IKI)
ALDR_HUMAN
[Raw transfer]




NDP_A_3(2PEV)
ALDR_HUMAN
[Raw transfer]




NDP_A_3(2PF8)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3V35)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(1Z8A)
ALDR_HUMAN
[Raw transfer]




NDP_A_2(2BGS)
ALDR_HORVU
[Raw transfer]




NAP_A_2(2IKJ)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2FZ9)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(4GCA)
ALDR_HUMAN
[Raw transfer]




NAP_A_3(1PWL)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2DV0)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2PDK)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2HVN)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2PD5)
ALDR_HUMAN
[Raw transfer]




ZST_A_3(2DV0)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(1Z89)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2FZ8)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2NVD)
ALDR_HUMAN
[Raw transfer]




TOL_A_3(2PDL)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3U2C)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3BCJ)
ALDR_HUMAN
[Raw transfer]




NDP_A_2(3GHU)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3S3G)
ALDR_HUMAN
[Raw transfer]




TOL_A_3(2FZB)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2IKG)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3P2V)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3LEN)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2IKH)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2PZN)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(1T41)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(1X98)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(1X97)
ALDR_HUMAN
[Raw transfer]




62P_A_3(1Z89)
ALDR_HUMAN
[Raw transfer]




CIT_A_3(1X98)
ALDR_HUMAN
[Raw transfer]




LDT_A_4(2PF8)
ALDR_HUMAN
[Raw transfer]




CIT_A_3(1X96)
ALDR_HUMAN
[Raw transfer]




NAP_A_3(4GIE)
PGFS_TRYCC
[Raw transfer]




CIT_A_3(3BCJ)
ALDR_HUMAN
[Raw transfer]




SUZ_A_7(3U2C)
ALDR_HUMAN
[Raw transfer]




NAP_A_3(1VP5)
?
[Raw transfer]




NAP_A_2(3H7R)
AKRC8_ARATH
[Raw transfer]




GOL_H_8(1MZR)
DKGA_ECOLI
[Raw transfer]




NAP_A_2(3H7U)
AKRC9_ARATH
[Raw transfer]




NAP_A_4(3BUV)
AK1D1_HUMAN
[Raw transfer]




NAP_A_2(2DUZ)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2FZB)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2PDL)
ALDR_HUMAN
[Raw transfer]




NAP_A_3(3KRB)
?
[Raw transfer]




NAP_A_2(3DN5)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2DUX)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2NVC)
ALDR_HUMAN
[Raw transfer]




NAP_A_3(1S1P)
AK1C3_HUMAN
[Raw transfer]




NTI_A_3(3V35)
ALDR_HUMAN
[Raw transfer]




DMF_A_4(3V35)
ALDR_HUMAN
[Raw transfer]




EDO_A_3(4GAC)
AK1A1_MOUSE
[Raw transfer]




EDO_A_10(4F40)
PGFS_LEIMA
[Raw transfer]




NAP_B_2(1EKO)
ALDR_PIG
[Raw transfer]




CIT_A_6(3U2C)
ALDR_HUMAN
[Raw transfer]




NA7_A_3(2WZM)
Y2407_MYCS2
[Raw transfer]




DMF_A_8(3V35)
ALDR_HUMAN
[Raw transfer]




CIT_A_4(3T42)
ALDR_HUMAN
[Raw transfer]




I84_C_3(1EKO)
ALDR_PIG
[Raw transfer]




NAP_A_3(3Q65)
ALDR_HUMAN
[Raw transfer]




23 PsiBlast_CBE 98.0886%-119 - C7 -3Q65 13.1 ALDR_HUMAN
52 PsiBlast_CBE 97.8886%-121 - C7 -1Z3N 13.7 ALDR_HUMAN
49 PsiBlast_CBE 97.8786%-120 - C7 -4GCA 13.7 ALDR_HUMAN
39 PsiBlast_CBE 97.8286%-120 - C7 -2J8T 13.6 ALDR_HUMAN
43 PsiBlast_CBE 97.7686%-121 - C7 -2IKG 13.6 ALDR_HUMAN
38 PsiBlast_CBE 97.7686%-122 - C7 -2NVC 13.3 ALDR_HUMAN
24 PsiBlast_CBE 97.7686%-120 - C7 -3P2V 13.5 ALDR_HUMAN
13 PsiBlast_PDB 97.7486%-120 - C7 -1Z8A 13.5 ALDR_HUMAN
50 PsiBlast_CBE 97.6786%-119 - C7 -3T42 13.2 ALDR_HUMAN
22 PsiBlast_CBE 97.6186%-119 - C7 -3Q65 12.5 ALDR_HUMAN
32 PsiBlast_CBE 97.5886%-120 - C7 -2PZN 13.7 ALDR_HUMAN
8 PsiBlast_PDB 97.5886%-122 - C7 -1T41 13.2 ALDR_HUMAN
11 PsiBlast_PDB 97.5786%-119 - C7 -1X98 13.4 ALDR_HUMAN
3 PsiBlast_PDB 97.5686%-118 - C7 -2PDK 13.8 ALDR_HUMAN
58 PsiBlast_CBE 97.5386%-119 - C7 -3V36 13.3 ALDR_HUMAN
4 PsiBlast_PDB 97.4986%-119 - C7 -2PDL 13.7 ALDR_HUMAN
16 PsiBlast_PDB 97.3886%-119 - C7 -2DUX 13.7 ALDR_HUMAN
42 PsiBlast_CBE 97.3786%-119 - C7 -2IKH 13.6 ALDR_HUMAN
35 PsiBlast_CBE 97.2886%-121 - C7 -2PEV 13.6 ALDR_HUMAN
26 PsiBlast_CBE 97.2886%-122 - C7 -3GHT 13.7 ALDR_HUMAN
21 PsiBlast_CBE 97.2486%-120 - C7 -3U2C 13.7 ALDR_HUMAN
20 PsiBlast_PDB 97.2286%-118 - C7 -2FZ9 13.7 ALDR_HUMAN
44 PsiBlast_CBE 97.1986%-119 - C7 -2HVO 13.5 ALDR_HUMAN
30 PsiBlast_CBE 97.1886%-118 - C7 -3BCJ 13.1 ALDR_HUMAN
54 PsiBlast_CBE 97.1486%-120 - C7 -2PD5 13.5 ALDR_HUMAN
25 PsiBlast_CBE 97.1486%-120 - C7 -3GHU 13.7 ALDR_HUMAN
9 PsiBlast_PDB 97.1386%-119 - C7 -1X96 13.2 ALDR_HUMAN
17 PsiBlast_PDB 97.1286%-119 - C7 -2DUZ 13.2 ALDR_HUMAN
51 PsiBlast_CBE 97.0986%-121 - C7 -3G5E 13.7 ALDR_HUMAN
27 PsiBlast_CBE 97.0686%-119 - C7 -3GHS 13.6 ALDR_HUMAN
12 PsiBlast_PDB 97.0686%-120 - C7 -1Z89 13.7 ALDR_HUMAN
28 PsiBlast_CBE 97.0586%-120 - C7 -3GHR 13.6 ALDR_HUMAN
40 PsiBlast_CBE 96.9886%-120 - C7 -2IKJ 13.2 ALDR_HUMAN
56 PsiBlast_CBE 96.9686%-120 - C7 -3LEN 13.4 ALDR_HUMAN
45 PsiBlast_CBE 96.8986%-117 - C7 -2HVN 13.5 ALDR_HUMAN
29 PsiBlast_CBE 96.8286%-120 - C7 -3DN5 13.5 ALDR_HUMAN
5 PsiBlast_PDB 96.8286%-120 - C7 -1PWL 13.4 ALDR_HUMAN
10 PsiBlast_PDB 96.7886%-119 - C7 -1X97 13.2 ALDR_HUMAN
36 PsiBlast_CBE 96.7486%-117 - C7 -2PDG 13.4 ALDR_HUMAN
19 PsiBlast_PDB 96.7486%-117 - C7 -2FZ8 13.7 ALDR_HUMAN
59 PsiBlast_CBE 96.7386%-118 - C7 -3V35 13.5 ALDR_HUMAN
37 PsiBlast_CBE 96.7086%-118 - C7 -2NVD 12.9 ALDR_HUMAN
31 PsiBlast_CBE 96.5386%-122 - C7 -2QXW 13.6 ALDR_HUMAN
48 PsiBlast_CBE 96.5186%-119 - C7 -2FZB 13.9 ALDR_HUMAN
46 PsiBlast_CBE 96.4786%-118 - C7 -2HV5 13.7 ALDR_HUMAN
6 PsiBlast_PDB 96.4786%-119 - C7 -1PWM 13.4 ALDR_HUMAN
34 PsiBlast_CBE 96.4386%-122 - C7 -2PF8 13.6 ALDR_HUMAN
60 PsiBlast_CBE 96.3486%-117 - C7 -3S3G 13.2 ALDR_HUMAN
47 PsiBlast_CBE 96.3486%-116 - C7 -2FZD 13.5 ALDR_HUMAN
53 PsiBlast_CBE 96.3186%-118 - C7 -2PD9 13.6 ALDR_HUMAN
41 PsiBlast_CBE 96.1186%-123 - C7 -2IKI 13.5 ALDR_HUMAN
18 PsiBlast_PDB 96.0086%-118 - C7 -2DV0 13.2 ALDR_HUMAN
75 HHSearch 84.2550%-109 - C7 -3BUV 13.1 AK1D1_HUMAN
77 HHSearch 83.8849%-111 - C7 -4GAC 2.8 AK1A1_MOUSE
76 HHSearch 81.0148%-107 - C7 -1S1P 12.6 AK1C3_HUMAN
83 HHSearch 76.1842%-103 - C7 -3KRB 12.7 ?
84 HHSearch 74.2937%-113 - C7 -4IJR 8.9 ARA1_YEAST
86 HHSearch 74.2745%-105 - C7 -3H7U 12.4 AKRC9_ARATH
82 HHSearch 74.2242%-112 - C7 -2BGS 11.8 ALDR_HORVU
92 HHSearch 71.2341%-111 - C7 -4GIE 13.8 PGFS_TRYCC
90 HHSearch 70.9242%-107 - C7 -3H7R 12.2 AKRC8_ARATH
88 HHSearch 70.3246%-110 - C7 -4F40 2.8 PGFS_LEIMA
93 HHSearch 68.4542%-110 - C7 -1MZR 3.2 DKGA_ECOLI
87 HHSearch 68.2841%-105 - C7 -1VP5 12.1 ?
89 HHSearch 66.4137%-109 - C7 -2WZM 7.1 Y2407_MYCS2
2 PsiBlast_PDB 63.2690% -8 - C7 -1EKO 7.1 ALDR_PIG