@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00248_ALDR_R: (2014-09-03 )
MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV

Atome Classification :

(69 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

0PY_A_4(3V36)
ALDR_HUMAN
[Raw transfer]




ITA_A_3(2NVC)
ALDR_HUMAN
[Raw transfer]




ITB_A_3(2NVD)
ALDR_HUMAN
[Raw transfer]




3T4_A_3(3T42)
ALDR_HUMAN
[Raw transfer]




I84_C_3(1EL3)
ALDR_HUMAN
[Raw transfer]




DOY_A_3(3P2V)
ALDR_HUMAN
[Raw transfer]




ZST_A_3(2HVN)
ALDR_HUMAN
[Raw transfer]




Q74_A_3(3G5E)
ALDR_HUMAN
[Raw transfer]




47D_A_3(2PDG)
ALDR_HUMAN
[Raw transfer]




393_A_3(2PZN)
ALDR_HUMAN
[Raw transfer]




3NA_A_3(1Z3N)
ALDR_HUMAN
[Raw transfer]




SLO_A_3(3RX2)
ALDR_HUMAN
[Raw transfer]




BTO_A_3(2IKG)
ALDR_HUMAN
[Raw transfer]




3GR_A_3(3V36)
ALDR_HUMAN
[Raw transfer]




53N_A_3(3DN5)
ALDR_HUMAN
[Raw transfer]




SUZ_A_3(3RX3)
ALDR_HUMAN
[Raw transfer]




393_A_3(2IKJ)
ALDR_HUMAN
[Raw transfer]




EPR_A_2(4JIR)
ALDR_HUMAN
[Raw transfer]




ID5_C_3(1T40)
ALDR_HUMAN
[Raw transfer]




TLT_A_3(3S3G)
ALDR_HUMAN
[Raw transfer]




ZST_A_3(2DUX)
ALDR_HUMAN
[Raw transfer]




LIT_A_3(2IKH)
ALDR_HUMAN
[Raw transfer]




CIT_A_3(3BCJ)
ALDR_HUMAN
[Raw transfer]




CIT_A_3(1X98)
ALDR_HUMAN
[Raw transfer]




TOL_A_3(2FZD)
ALDR_HUMAN
[Raw transfer]




SBI_A_3(2PDK)
ALDR_HUMAN
[Raw transfer]




SFI_A_3(3RX4)
ALDR_HUMAN
[Raw transfer]




ID5_A_3(1T41)
ALDR_HUMAN
[Raw transfer]




CIT_A_3(1X96)
ALDR_HUMAN
[Raw transfer]




LDT_A_3(3GHS)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2PDG)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3BCJ)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2HVO)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3P2V)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(1T41)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2FZD)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(1Z89)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(1X96)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2IKI)
ALDR_HUMAN
[Raw transfer]




NDP_A_3(2PEV)
ALDR_HUMAN
[Raw transfer]




ZST_A_3(2DUZ)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3V35)
ALDR_HUMAN
[Raw transfer]




NDP_A_3(2PF8)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(1X97)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2PDK)
ALDR_HUMAN
[Raw transfer]




NDP_A_2(3GHR)
ALDR_HUMAN
[Raw transfer]




NAP_A_5(4JIR)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3RX2)
ALDR_HUMAN
[Raw transfer]




NAP_A_3(3Q65)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(1Z8A)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2PZN)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3T42)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3V36)
ALDR_HUMAN
[Raw transfer]




NDP_A_2(3GHT)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2IKH)
ALDR_HUMAN
[Raw transfer]




388_A_3(2IKI)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3RX4)
ALDR_HUMAN
[Raw transfer]




TOL_A_3(2PDL)
ALDR_HUMAN
[Raw transfer]




NDP_A_2(2QXW)
ALDR_HUMAN
[Raw transfer]




NDP_A_2(1Z3N)
ALDR_HUMAN
[Raw transfer]




NDP_B_2(2F2K)
ALDR_HUMAN
[Raw transfer]




LDT_A_3(3GHT)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2IKG)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2HVN)
ALDR_HUMAN
[Raw transfer]




NAP_A_3(1PWL)
ALDR_HUMAN
[Raw transfer]




NDP_A_2(2BGS)
ALDR_HORVU
[Raw transfer]




NAP_B_2(1EL3)
ALDR_HUMAN
[Raw transfer]




NDP_A_2(3GHU)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2DV0)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2HV5)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2NVD)
ALDR_HUMAN
[Raw transfer]




NDP_A_3(4IJR)
ARA1_YEAST
[Raw transfer]




NAP_A_2(2J8T)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3S3G)
ALDR_HUMAN
[Raw transfer]




NAP_B_2(1T40)
ALDR_HUMAN
[Raw transfer]




LDT_A_3(3GHR)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3U2C)
ALDR_HUMAN
[Raw transfer]




LDT_A_3(3GHU)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2IKJ)
ALDR_HUMAN
[Raw transfer]




TOL_A_3(2FZB)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(1X98)
ALDR_HUMAN
[Raw transfer]




62P_A_3(1Z89)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2FZ8)
ALDR_HUMAN
[Raw transfer]




NAP_A_3(1PWM)
ALDR_HUMAN
[Raw transfer]




NDP_A_2(3GHS)
ALDR_HUMAN
[Raw transfer]




NDP_A_2(3G5E)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2FZ9)
ALDR_HUMAN
[Raw transfer]




ZST_A_3(2HV5)
ALDR_HUMAN
[Raw transfer]




ZST_A_3(2FZ9)
ALDR_HUMAN
[Raw transfer]




LDT_A_3(2QXW)
ALDR_HUMAN
[Raw transfer]




BFI_A_2(1PWL)
ALDR_HUMAN
[Raw transfer]




NAP_A_3(4GIE)
PGFS_TRYCC
[Raw transfer]




NAP_A_3(1VP5)
?
[Raw transfer]




NAP_A_4(3BUV)
AK1D1_HUMAN
[Raw transfer]




NAP_A_2(3H7R)
AKRC8_ARATH
[Raw transfer]




ZST_A_3(2FZ8)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3H7U)
AKRC9_ARATH
[Raw transfer]




ZES_A_3(1IEI)
ALDR_HUMAN
[Raw transfer]




SUZ_A_7(3U2C)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(1IEI)
ALDR_HUMAN
[Raw transfer]




ZST_A_3(2HVO)
ALDR_HUMAN
[Raw transfer]




ZST_A_3(2DV0)
ALDR_HUMAN
[Raw transfer]




GOL_H_8(1MZR)
DKGA_ECOLI
[Raw transfer]




NAP_A_2(2NVC)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2DUZ)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3DN5)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2PDL)
ALDR_HUMAN
[Raw transfer]




LDT_A_4(2PEV)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2FZB)
ALDR_HUMAN
[Raw transfer]




LDT_A_4(2PF8)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(2DUX)
ALDR_HUMAN
[Raw transfer]




NAP_A_3(3KRB)
?
[Raw transfer]




NTI_A_3(3V35)
ALDR_HUMAN
[Raw transfer]




NAP_A_2(3RX3)
ALDR_HUMAN
[Raw transfer]




DMF_A_4(3V35)
ALDR_HUMAN
[Raw transfer]




NAP_A_3(1S1P)
AK1C3_HUMAN
[Raw transfer]




EDO_A_3(4GAC)
AK1A1_MOUSE
[Raw transfer]




EDO_A_10(4F40)
PGFS_LEIMA
[Raw transfer]




DMF_A_23(3V35)
ALDR_HUMAN
[Raw transfer]




CIT_A_6(3U2C)
ALDR_HUMAN
[Raw transfer]




NA7_A_3(2WZM)
Y2407_MYCS2
[Raw transfer]




TGG_C_3(2F2K)
ALDR_HUMAN
[Raw transfer]




NAP_A_3(3Q65)
ALDR_HUMAN
[Raw transfer]




10 PsiBlast_PDB 98.7385%-112 - C7 -3RX4 13.2 ALDR_HUMAN
11 PsiBlast_PDB 98.7085%-112 - C7 -3S3G 13.2 ALDR_HUMAN
23 PsiBlast_CBE 98.6585%-115 - C7 -3Q65 13.1 ALDR_HUMAN
7 PsiBlast_PDB 98.6485%-115 - C7 -4JIR 13.5 ALDR_HUMAN
13 PsiBlast_PDB 98.6385%-112 - C7 -3V36 13.3 ALDR_HUMAN
56 PsiBlast_CBE 98.5485%-113 - C7 -1Z8A 13.5 ALDR_HUMAN
8 PsiBlast_PDB 98.5485%-114 - C7 -3RX2 13.2 ALDR_HUMAN
9 PsiBlast_PDB 98.4485%-113 - C7 -3RX3 13.0 ALDR_HUMAN
22 PsiBlast_CBE 98.4285%-113 - C7 -3Q65 2.3 ALDR_HUMAN
3 PsiBlast_PDB 98.3985%-114 - C7 -1EL3 14.0 ALDR_HUMAN
58 PsiBlast_CBE 98.3585%-114 - C7 -1X98 13.4 ALDR_HUMAN
32 PsiBlast_CBE 98.3285%-115 - C7 -2PZN 13.7 ALDR_HUMAN
59 PsiBlast_CBE 98.3085%-114 - C7 -1X97 13.2 ALDR_HUMAN
5 PsiBlast_PDB 98.2985%-113 - C7 -1T40 14.0 ALDR_HUMAN
39 PsiBlast_CBE 98.2385%-113 - C7 -2J8T 13.6 ALDR_HUMAN
60 PsiBlast_CBE 98.1385%-113 - C7 -1X96 13.2 ALDR_HUMAN
12 PsiBlast_PDB 98.1285%-113 - C7 -3V35 13.5 ALDR_HUMAN
2 PsiBlast_PDB 98.0785%-112 - C7 -2PDL 13.7 ALDR_HUMAN
42 PsiBlast_CBE 98.0685%-112 - C7 -2IKH 13.6 ALDR_HUMAN
6 PsiBlast_PDB 98.0485%-112 - C7 -2F2K 12.9 ALDR_HUMAN
21 PsiBlast_CBE 98.0385%-113 - C7 -3U2C 13.7 ALDR_HUMAN
47 PsiBlast_CBE 98.0285%-111 - C7 -2HVN 13.5 ALDR_HUMAN
15 PsiBlast_PDB 97.9985%-115 - C7 -3G5E 13.7 ALDR_HUMAN
1 PsiBlast_PDB 97.9885%-111 - C7 -2PDK 13.8 ALDR_HUMAN
18 PsiBlast_PDB 97.9585%-113 - C7 -1PWM 13.4 ALDR_HUMAN
43 PsiBlast_CBE 97.9385%-114 - C7 -2IKG 13.6 ALDR_HUMAN
54 PsiBlast_CBE 97.8885%-112 - C7 -2DUZ 13.3 ALDR_HUMAN
36 PsiBlast_CBE 97.8885%-111 - C7 -2PDG 13.4 ALDR_HUMAN
25 PsiBlast_CBE 97.8585%-116 - C7 -3GHU 13.7 ALDR_HUMAN
30 PsiBlast_CBE 97.8385%-112 - C7 -3BCJ 13.1 ALDR_HUMAN
46 PsiBlast_CBE 97.8285%-112 - C7 -2HVO 13.4 ALDR_HUMAN
55 PsiBlast_CBE 97.8185%-112 - C7 -2DUX 13.7 ALDR_HUMAN
38 PsiBlast_CBE 97.7785%-115 - C7 -2NVC 13.3 ALDR_HUMAN
26 PsiBlast_CBE 97.7385%-117 - C7 -3GHT 13.7 ALDR_HUMAN
51 PsiBlast_CBE 97.7185%-112 - C7 -2FZ9 13.7 ALDR_HUMAN
14 PsiBlast_PDB 97.6385%-115 - C7 -1Z3N 13.7 ALDR_HUMAN
27 PsiBlast_CBE 97.5385%-115 - C7 -3GHS 13.6 ALDR_HUMAN
31 PsiBlast_CBE 97.5185%-115 - C7 -2QXW 13.6 ALDR_HUMAN
40 PsiBlast_CBE 97.4885%-114 - C7 -2IKJ 13.2 ALDR_HUMAN
57 PsiBlast_CBE 97.4785%-112 - C7 -1Z89 13.7 ALDR_HUMAN
20 PsiBlast_PDB 97.4685%-115 - C7 -1T41 13.2 ALDR_HUMAN
52 PsiBlast_CBE 97.4385%-112 - C7 -2FZ8 13.7 ALDR_HUMAN
49 PsiBlast_CBE 97.4285%-111 - C7 -2FZD 13.5 ALDR_HUMAN
50 PsiBlast_CBE 97.3585%-113 - C7 -2FZB 13.9 ALDR_HUMAN
24 PsiBlast_CBE 97.3085%-115 - C7 -3P2V 13.5 ALDR_HUMAN
28 PsiBlast_CBE 97.2885%-115 - C7 -3GHR 13.6 ALDR_HUMAN
35 PsiBlast_CBE 97.2285%-114 - C7 -2PEV 13.6 ALDR_HUMAN
37 PsiBlast_CBE 97.1185%-112 - C7 -2NVD 12.9 ALDR_HUMAN
16 PsiBlast_PDB 97.1185%-114 - C7 -3T42 13.2 ALDR_HUMAN
48 PsiBlast_CBE 97.0285%-113 - C7 -2HV5 13.7 ALDR_HUMAN
29 PsiBlast_CBE 96.8785%-114 - C7 -3DN5 13.5 ALDR_HUMAN
17 PsiBlast_PDB 96.8785%-114 - C7 -1PWL 13.4 ALDR_HUMAN
41 PsiBlast_CBE 96.7885%-117 - C7 -2IKI 13.5 ALDR_HUMAN
34 PsiBlast_CBE 96.7085%-116 - C7 -2PF8 13.6 ALDR_HUMAN
53 PsiBlast_CBE 96.6785%-111 - C7 -2DV0 13.2 ALDR_HUMAN
4 PsiBlast_PDB 96.3685%-109 - C7 -1IEI 12.0 ALDR_HUMAN
77 HHSearch 86.9951%-105 - C7 -4GAC 2.8 AK1A1_MOUSE
75 HHSearch 85.9549%-105 - C7 -3BUV 13.1 AK1D1_HUMAN
76 HHSearch 82.0147%-101 - C7 -1S1P 12.6 AK1C3_HUMAN
86 HHSearch 78.6046%-102 - C7 -3H7U 12.4 AKRC9_ARATH
83 HHSearch 78.3943%-101 - C7 -3KRB 12.7 ?
82 HHSearch 77.3243%-107 - C7 -2BGS 11.8 ALDR_HORVU
84 HHSearch 74.4737%-110 - C7 -4IJR 8.9 ARA1_YEAST
89 HHSearch 74.3043%-103 - C7 -3H7R 12.2 AKRC8_ARATH
88 HHSearch 72.8146%-103 - C7 -4F40 2.8 PGFS_LEIMA
87 HHSearch 71.8240%-100 - C7 -1VP5 12.1 ?
92 HHSearch 71.5742%-105 - C7 -4GIE 13.8 PGFS_TRYCC
93 HHSearch 71.1541%-105 - C7 -1MZR 3.2 DKGA_ECOLI
91 HHSearch 68.4338%-104 - C7 -2WZM 7.1 Y2407_MYCS2