@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00303_TYSY_L: (2014-09-04 )
MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSKGFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTSKGDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVNDGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDFDMKDIKLLNYDPYPAIKAPVAV

Atome Classification :

(54 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

UMP_A_2(3BYX)
TYSY_LACCA
[Raw transfer]




U_E_5(1BO8)
TYSY_LACCA
[Raw transfer]




UMP_A_2(2G8A)
TYSY_LACCA
[Raw transfer]




UFP_C_3(1TDB)
TYSY_LACCA
[Raw transfer]




UMP_A_2(2TDM)
TYSY_LACCA
[Raw transfer]




U_A_2(1BO7)
TYSY_LACCA
[Raw transfer]




UMP_A_2(2G89)
TYSY_LACCA
[Raw transfer]




UMP_A_2(2G86)
TYSY_LACCA
[Raw transfer]




UMP_A_2(1TSX)
TYSY_LACCA
[Raw transfer]




UMP_A_3(4FQS)
TYSY_MYCTU
[Raw transfer]




UMP_A_3(4DQ1)
TYSY_STAAM
[Raw transfer]




UMP_C_3(1TSY)
TYSY_LACCA
[Raw transfer]




UMP_A_2(3C06)
TYSY_LACCA
[Raw transfer]




UMP_A_3(3BNZ)
TYSY_LACCA
[Raw transfer]




UMP_A_6(3NRR)
?
[Raw transfer]




UMP_E_5(1BPJ)
TYSY_LACCA
[Raw transfer]




DCM_C_3(1NJA)
TYSY_LACCA
[Raw transfer]




UMP_A_2(2G8D)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1TSV)
TYSY_LACCA
[Raw transfer]




DCM_C_3(1NJE)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1TVU)
TYSY_LACCA
[Raw transfer]




NOH_A_2(4EZ8)
TYSY_MOUSE
[Raw transfer]




DCM_C_3(1NJC)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1TVW)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1VZA)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1THY)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1TDC)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1VZB)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1JMI)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1JMF)
TYSY_LACCA
[Raw transfer]




UMP_E_5(1F28)
TYSY_PNECA
[Raw transfer]




UMP_A_2(3BZ0)
TYSY_LACCA
[Raw transfer]




UMP_C_7(1J3K)
?
[Raw transfer]




UMP_E_5(1BP0)
TYSY_LACCA
[Raw transfer]




UMP_E_5(1BP6)
TYSY_LACCA
[Raw transfer]




UMP_A_3(3IK1)
TYSY_LACCA
[Raw transfer]




UFP_C_3(1VZC)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1TVV)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1NJD)
TYSY_LACCA
[Raw transfer]




UMP_A_2(3C0A)
TYSY_LACCA
[Raw transfer]




UMP_A_5(4G9U)
?
[Raw transfer]




UMP_C_3(1JMG)
TYSY_LACCA
[Raw transfer]




UMP_A_3(3IK0)
TYSY_LACCA
[Raw transfer]




DHF_A_3(4EZ8)
TYSY_MOUSE
[Raw transfer]




CB3_E_5(1TVV)
TYSY_LACCA
[Raw transfer]




UFP_E_5(2TDD)
TYSY_LACCA
[Raw transfer]




UMP_A_5(3QG2)
?
[Raw transfer]




UMP_A_3(3IJZ)
TYSY_LACCA
[Raw transfer]




CB3_E_5(1TVU)
TYSY_LACCA
[Raw transfer]




TMF_E_5(1LCE)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1LCE)
TYSY_LACCA
[Raw transfer]




UMP_C_3(1JMH)
TYSY_LACCA
[Raw transfer]




LYA_A_4(4FQS)
TYSY_MYCTU
[Raw transfer]




UMP_C_3(1NJB)
TYSY_LACCA
[Raw transfer]




THF_C_3(2TDD)
TYSY_LACCA
[Raw transfer]




D16_A_7(3NRR)
?
[Raw transfer]




F89_I_9(1F28)
TYSY_PNECA
[Raw transfer]




CB3_E_5(1TVW)
TYSY_LACCA
[Raw transfer]




DTT_A_6(4G9U)
?
[Raw transfer]




CIT_A_5(3V8H)
?
[Raw transfer]




MR2_E_5(1TSM)
TYSY_LACCA
[Raw transfer]




A15_A_3(1TSL)
TYSY_LACCA
[Raw transfer]




7C1_A_2(3IK0)
TYSY_LACCA
[Raw transfer]




20C_A_2(3IK1)
TYSY_LACCA
[Raw transfer]




C16_A_4(3BNZ)
TYSY_LACCA
[Raw transfer]




FOZ_D_17(3UWL)
TYSY_ENTFA
[Raw transfer]




FOZ_B_7(3UWL)
TYSY_ENTFA
[Raw transfer]




33 PsiBlast_CBE 97.94100%-125 - C8 -1THY 3.9 TYSY_LACCA
28 PsiBlast_CBE 97.90100%-127 - C8 -3BYX 3.7 TYSY_LACCA
47 PsiBlast_CBE 97.7199%-123 - C8 -1BP6 5.1 TYSY_LACCA
44 PsiBlast_CBE 97.6999%-121 - C8 -1JMH 3.4 TYSY_LACCA
31 PsiBlast_CBE 97.53100%-121 - C8 -1TSM 3.1 TYSY_LACCA
1 PsiBlast_PDB 97.5099%-123 - C8 -1TSY 4.5 TYSY_LACCA
32 PsiBlast_CBE 97.36100%-125 - C8 -1TSL 5.1 TYSY_LACCA
12 PsiBlast_PDB 97.2399%-122 - C8 -1BO8 4.4 TYSY_LACCA
19 PsiBlast_PDB 97.2299%-126 - C8 -1JMF 4.2 TYSY_LACCA
14 PsiBlast_PDB 97.2199%-124 - C8 -1NJD 4.7 TYSY_LACCA
17 PsiBlast_PDB 97.0699%-125 - C8 -1JMG 3.7 TYSY_LACCA
43 PsiBlast_CBE 97.0499%-123 - C8 -1BP0 4.7 TYSY_LACCA
13 PsiBlast_PDB 96.9699%-124 - C8 -1NJC 4.7 TYSY_LACCA
37 PsiBlast_CBE 96.8699%-122 - C8 -2G89 4.7 TYSY_LACCA
38 PsiBlast_CBE 96.8199%-123 - C8 -1TVV 4.6 TYSY_LACCA
11 PsiBlast_PDB 96.8199%-122 - C8 -1BO7 5.5 TYSY_LACCA
39 PsiBlast_CBE 96.8099%-125 - C8 -1NJB 3.8 TYSY_LACCA
34 PsiBlast_CBE 96.80100%-123 - C8 -1NJE 4.2 TYSY_LACCA
46 PsiBlast_CBE 96.7499%-122 - C8 -1BPJ 3.7 TYSY_LACCA
42 PsiBlast_CBE 96.6999%-122 - C8 -1VZB 4.2 TYSY_LACCA
45 PsiBlast_CBE 96.6499%-119 - C8 -1VZA 4.3 TYSY_LACCA
41 PsiBlast_CBE 96.6099%-127 - C8 -1VZC 4.3 TYSY_LACCA
20 PsiBlast_PDB 96.5099%-125 - C8 -1TVU 5.8 TYSY_LACCA
36 PsiBlast_CBE 96.4999%-119 - C8 -2G8A 5.3 TYSY_LACCA
15 PsiBlast_PDB 96.4399%-122 - C8 -1TSV 5.4 TYSY_LACCA
10 PsiBlast_PDB 96.4399%-124 - C8 -1TSX 4.9 TYSY_LACCA
7 PsiBlast_PDB 96.3299%-119 - C8 -2G86 5.6 TYSY_LACCA
35 PsiBlast_CBE 96.18100%-121 - C8 -1LCE 4.9 TYSY_LACCA
40 PsiBlast_CBE 96.1799%-121 - C8 -1NJA 4.6 TYSY_LACCA
24 PsiBlast_CBE 96.09100%-130 - C8 -3IJZ 3.6 TYSY_LACCA
23 PsiBlast_CBE 96.09100%-127 - C8 -3IK0 4.1 TYSY_LACCA
22 PsiBlast_CBE 95.80100%-129 - C8 -3IK1 3.8 TYSY_LACCA
29 PsiBlast_CBE 95.70100%-123 - C8 -3BNZ 4.0 TYSY_LACCA
5 PsiBlast_PDB 95.68100%-124 - C8 -1TDC 3.8 TYSY_LACCA
30 PsiBlast_CBE 95.67100%-118 - C8 -2TDM 5.7 TYSY_LACCA
18 PsiBlast_PDB 95.6799%-119 - C8 -2G8D 4.8 TYSY_LACCA
27 PsiBlast_CBE 95.64100%-128 - C8 -3BZ0 3.4 TYSY_LACCA
9 PsiBlast_PDB 95.4799%-120 - C8 -1TVW 5.0 TYSY_LACCA
26 PsiBlast_CBE 95.38100%-123 - C8 -3C06 4.1 TYSY_LACCA
8 PsiBlast_PDB 95.0699%-121 - C8 -1JMI 4.3 TYSY_LACCA
4 PsiBlast_PDB 94.95100%-122 - C8 -1TDB 3.1 TYSY_LACCA
6 PsiBlast_PDB 94.93100%-121 - C8 -2TDD 3.9 TYSY_LACCA
25 PsiBlast_CBE 94.51100%-133 - C8 -3C0A 4.1 TYSY_LACCA
63 HHSearch 87.5564%-123 - C8 -4DQ1 4.8 TYSY_STAAM
50 PsiBlast_CBE 78.8973% -73 - C8 -3UWL 3.0 TYSY_ENTFA
51 PsiBlast_CBE 78.2373% -73 - C8 -3UWL 3.2 TYSY_ENTFA
81 HHSearch 75.8646%-120 - C8 -3QG2 4.6 ?
75 HHSearch 75.4960%-118 - C8 -4FQS 5.4 TYSY_MYCTU
65 HHSearch 75.1850%-109 - C8 -4EZ8 6.0 TYSY_MOUSE
68 HHSearch 74.0649%-112 - C8 -1F28 6.7 TYSY_PNECA
74 HHSearch 73.2249%-119 - C8 -3NRR 5.7 ?
70 HHSearch 73.0346%-116 - C8 -1J3K 5.4 ?
67 HHSearch 72.3450%-118 - C8 -4G9U 5.4 ?
73 HHSearch 64.7439% -99 - C8 -3V8H 3.2 ?