@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00551_PUR3_E: (2014-09-11 )
MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYAADE

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

138_H_8(1JKX)
PUR3_ECOLI
[Raw transfer]




KT5_C_3(1RBZ)
PUR2_HUMAN
[Raw transfer]




NHS_E_5(1C2T)
PUR3_ECOLI
[Raw transfer]




NHR_C_3(1C3E)
PUR3_ECOLI
[Raw transfer]




NHS_C_3(1C2T)
PUR3_ECOLI
[Raw transfer]




NHR_E_5(1C3E)
PUR3_ECOLI
[Raw transfer]




KEU_E_5(1RBY)
PUR2_HUMAN
[Raw transfer]




KT5_C_3(1RC0)
PUR2_HUMAN
[Raw transfer]




KEU_F_6(1NJS)
PUR2_HUMAN
[Raw transfer]




KT5_G_7(1RBM)
PUR2_HUMAN
[Raw transfer]




KEU_K_11(1RBQ)
PUR2_HUMAN
[Raw transfer]




KT3_E_5(1RC1)
PUR2_HUMAN
[Raw transfer]




DZF_D_12(1CDE)
PUR3_ECOLI
[Raw transfer]




DZF_A_6(1CDE)
PUR3_ECOLI
[Raw transfer]




DZF_B_8(1CDE)
PUR3_ECOLI
[Raw transfer]




DZF_C_10(1CDE)
PUR3_ECOLI
[Raw transfer]




138_F_6(1JKX)
PUR3_ECOLI
[Raw transfer]




DQB_C_3(1ZLY)

[Raw transfer]




138_G_7(1JKX)
PUR3_ECOLI
[Raw transfer]




138_E_5(1JKX)
PUR3_ECOLI
[Raw transfer]




DXY_A_5(4EW2)

[Raw transfer]




GOL_A_6(4DS3)
?
[Raw transfer]




GOL_A_5(3KCQ)
?
[Raw transfer]




GAR_D_4(1C2T)
PUR3_ECOLI
[Raw transfer]




GAR_F_6(1C2T)
PUR3_ECOLI
[Raw transfer]




GAR_D_4(1C3E)
PUR3_ECOLI
[Raw transfer]




GAR_F_6(1C3E)
PUR3_ECOLI
[Raw transfer]




GAR_D_11(1CDE)
PUR3_ECOLI
[Raw transfer]




GAR_C_9(1CDE)
PUR3_ECOLI
[Raw transfer]




GAR_A_5(1CDE)
PUR3_ECOLI
[Raw transfer]




GAR_B_7(1CDE)
PUR3_ECOLI
[Raw transfer]




GAR_I_9(1RBY)
PUR2_HUMAN
[Raw transfer]




GAR_D_4(1MEN)
PUR2_HUMAN
[Raw transfer]




GRF_B_2(1ZLY)

[Raw transfer]




UNL_A_5(3LOU)
?
[Raw transfer]




23 PsiBlast_CBE 97.57100%-140 - C5 -1JKX 11.1 PUR3_ECOLI
32 PsiBlast_CBE 97.53100%-140 - C5 -1CDE 6.7 PUR3_ECOLI
29 PsiBlast_CBE 97.21100%-140 - C5 -1CDE 6.7 PUR3_ECOLI
21 PsiBlast_CBE 97.18100%-143 - C5 -1JKX 10.2 PUR3_ECOLI
22 PsiBlast_CBE 97.06100%-141 - C5 -1JKX 11.0 PUR3_ECOLI
24 PsiBlast_CBE 96.86100%-142 - C5 -1JKX 11.0 PUR3_ECOLI
30 PsiBlast_CBE 96.82100%-140 - C5 -1CDE 6.7 PUR3_ECOLI
36 PsiBlast_CBE 96.73100%-140 - C5 -1C3E 9.5 PUR3_ECOLI
34 PsiBlast_CBE 96.58100%-141 - C5 -1C2T 8.6 PUR3_ECOLI
31 PsiBlast_CBE 96.52100%-140 - C5 -1CDE 6.7 PUR3_ECOLI
4 PsiBlast_PDB 96.34100%-140 - C5 -1C3E 9.4 PUR3_ECOLI
35 PsiBlast_CBE 96.26100%-140 - C5 -1C2T 9.0 PUR3_ECOLI
15 PsiBlast_PDB 74.0041%-126 - C5 -1RBY 9.1 PUR2_HUMAN
17 PsiBlast_PDB 73.9641%-128 - C5 -1RC0 6.8 PUR2_HUMAN
12 PsiBlast_PDB 73.9541%-126 - C5 -1NJS 6.3 PUR2_HUMAN
18 PsiBlast_PDB 73.8841%-125 - C5 -1RC1 6.7 PUR2_HUMAN
20 PsiBlast_PDB 73.8641%-130 - C5 -4EW2 6.6
9 PsiBlast_PDB 73.6541%-125 - C5 -1MEN 4.1 PUR2_HUMAN
13 PsiBlast_PDB 73.5141%-125 - C5 -1RBM 5.1 PUR2_HUMAN
10 PsiBlast_PDB 73.3541%-126 - C5 -1ZLY 5.5
16 PsiBlast_PDB 73.3141%-129 - C5 -1RBZ 9.3 PUR2_HUMAN
14 PsiBlast_PDB 73.1141%-125 - C5 -1RBQ 6.8 PUR2_HUMAN
7 PsiBlast_PDB 71.8146%-127 - C5 -4DS3 2.1 ?
61 HHSearch 68.4136%-131 - C5 -3KCQ 2.5 ?