@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00908_RMLC_M: (2014-09-18 )
MKARELDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLDVRQVNCSVSSAGVLRGLHFAQLPPSQAKYVTCVSGSVFDVVVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHGFLALQDNSTVMYLCSAEYNPQREHTICATDPTLAVDWPLVDGAAPSLSDRDAAAPSFEDVRASGLLPRWEQTQRFIGEMRGT

Atome Classification :

(15 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TRH_C_7(2IXC)
RMLC_MYCTU
[Raw transfer]




TRH_A_5(2IXC)
RMLC_MYCTU
[Raw transfer]




TRH_B_6(2IXC)
RMLC_MYCTU
[Raw transfer]




TDO_A_3(2IXK)
RMLC_PSEAE
[Raw transfer]




TDO_A_3(2IXK)
RMLC_PSEAE
[Raw transfer]




18T_A_7(4HMZ)
CHMJ_STRBI
[Raw transfer]




TRH_A_3(2IXH)
RMLC_PSEAE
[Raw transfer]




SRT_C_3(1RTV)
RMLC_PSEAE
[Raw transfer]




SRT_A_3(2IXJ)
RMLC_PSEAE
[Raw transfer]




GOL_A_7(1DZR)
RMLC_SALTY
[Raw transfer]




SRT_A_4(2IXI)
RMLC_PSEAE
[Raw transfer]




TYD_A_3(2IXI)
RMLC_PSEAE
[Raw transfer]




TYD_A_9(4HN1)
CHMJ_STRBI
[Raw transfer]




TYD_A_9(4HN1)
CHMJ_STRBI
[Raw transfer]




TMP_A_3(1OI6)
?
[Raw transfer]




TMP_A_3(1OI6)
?
[Raw transfer]




POP_A_3(3RYK)
?
[Raw transfer]




POP_A_3(3RYK)
?
[Raw transfer]




EDO_A_5(4HN1)
CHMJ_STRBI
[Raw transfer]




EDO_A_5(4HN1)
CHMJ_STRBI
[Raw transfer]




EDO_A_7(4HN0)
CHMJ_STRBI
[Raw transfer]




18 PsiBlast_CBE 96.76100%-108 - C2 -2IXC 5.7 RMLC_MYCTU
19 PsiBlast_CBE 96.28100%-110 - C2 -2IXC 5.5 RMLC_MYCTU
2 PsiBlast_PDB 96.09100%-109 - C2 -2IXC 5.9 RMLC_MYCTU
17 PsiBlast_CBE 95.94100%-107 - C2 -2IXC - RMLC_MYCTU
33 HHSearch 77.3544% -96 - C2 -4HN1 2.6 CHMJ_STRBI
31 HHSearch 76.2640% -93 - C2 -1OI6 3.6 ?
5 PsiBlast_PDB 74.8447%-108 - C2 -4HN0 3.0 CHMJ_STRBI
6 PsiBlast_PDB 74.2047%-103 - C2 -4HMZ 5.1 CHMJ_STRBI
37 HHSearch 72.4139%-107 - C2 -2IXK 4.6 RMLC_PSEAE
12 PsiBlast_PDB 72.3640%-100 - C2 -2IXJ 3.3 RMLC_PSEAE
11 PsiBlast_PDB 71.6240%-105 - C2 -1RTV 4.1 RMLC_PSEAE
13 PsiBlast_PDB 71.4640%-103 - C2 -2IXH 5.8 RMLC_PSEAE
22 Fugue 71.4036%-103 - C2 -1DZR - RMLC_SALTY
14 PsiBlast_PDB 70.8440%-103 - C2 -2IXI 4.0 RMLC_PSEAE
36 HHSearch 67.3033%-110 - C2 -3RYK 3.4 ?