@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF01048_PNPH_H: (2014-09-19 )
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS

Atome Classification :

(40 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NOS_E_5(1RCT)
PNPH_HUMAN
[Raw transfer]




DIH_M_13(1RSZ)
PNPH_HUMAN
[Raw transfer]




GMP_M_13(1RFG)
PNPH_HUMAN
[Raw transfer]




DIH_A_5(3BGS)
PNPH_HUMAN
[Raw transfer]




DIH_J_10(2A0X)
PNPH_HUMAN
[Raw transfer]




IM5_C_10(4EB8)
PNPH_HUMAN
[Raw transfer]




22A_A_2(3K8Q)
PNPH_HUMAN
[Raw transfer]




IMH_M_13(1RT9)
PNPH_HUMAN
[Raw transfer]




IM5_B_7(4EB8)
PNPH_HUMAN
[Raw transfer]




IMH_M_13(1PF7)
PNPH_HUMAN
[Raw transfer]




DIH_J_10(2A0W)
PNPH_HUMAN
[Raw transfer]




IMH_M_13(1RR6)
PNPH_HUMAN
[Raw transfer]




DIH_J_10(2A0Y)
PNPH_HUMAN
[Raw transfer]




IMH_G_7(2OC9)
PNPH_HUMAN
[Raw transfer]




AC2_M_13(1PWY)
PNPH_HUMAN
[Raw transfer]




3DG_M_13(1V45)
PNPH_HUMAN
[Raw transfer]




IM5_A_5(4EB8)
PNPH_HUMAN
[Raw transfer]




IMH_G_7(2OC4)
PNPH_HUMAN
[Raw transfer]




DIH_A_8(2P4S)
?
[Raw transfer]




IMH_D_4(2ON6)
PNPH_HUMAN
[Raw transfer]




IMH_G_7(1G2O)
PUNA_MYCTU
[Raw transfer]




MSG_E_5(1YRY)
PNPH_HUMAN
[Raw transfer]




IMH_E_3(2Q7O)
PNPH_HUMAN
[Raw transfer]




2DI_M_13(1V3Q)
PNPH_HUMAN
[Raw transfer]




GUN_P_16(1V2H)
PNPH_HUMAN
[Raw transfer]




9DG_A_5(3FUC)
PNPH_BOVIN
[Raw transfer]




AZG_P_16(1V41)
PNPH_HUMAN
[Raw transfer]




GUN_J_10(1ULB)
PNPH_HUMAN
[Raw transfer]




7DG_A_5(3INY)
PNPH_HUMAN
[Raw transfer]




2FD_B_5(3GGS)
PNPH_HUMAN
[Raw transfer]




ADE_A_4(4LNA)
?
[Raw transfer]




ADE_A_4(4NSN)
?
[Raw transfer]




2FD_A_4(3GGS)
PNPH_HUMAN
[Raw transfer]




D1V_A_5(3D1V)
PNPH_HUMAN
[Raw transfer]




A2F_A_4(3GB9)
PNPH_HUMAN
[Raw transfer]




XAN_A_2(3ODG)
?
[Raw transfer]




A2F_B_5(3GB9)
PNPH_HUMAN
[Raw transfer]




A2F_C_6(3GB9)
PNPH_HUMAN
[Raw transfer]




9D9_A_4(3FUC)
PNPH_BOVIN
[Raw transfer]




NDS_G_7(1TCV)
?
[Raw transfer]




MPD_A_5(4LNA)
?
[Raw transfer]




36 PsiBlast_CBE 97.1299%-125 - C5 -1V41 4.8 PNPH_HUMAN
35 PsiBlast_CBE 97.0999%-127 - C5 -1V45 4.2 PNPH_HUMAN
10 PsiBlast_PDB 96.9699%-121 - C5 -3D1V 2.9 PNPH_HUMAN
1 PsiBlast_PDB 96.9499%-124 - C5 -1PF7 4.5 PNPH_HUMAN
15 PsiBlast_PDB 96.8899%-134 - C5 -3GB9 3.8 PNPH_HUMAN
32 PsiBlast_CBE 96.8399%-138 - C5 -3GGS 4.4 PNPH_HUMAN
19 PsiBlast_PDB 96.8099%-127 - C5 -1V2H 3.6 PNPH_HUMAN
12 PsiBlast_PDB 96.7499%-128 - C5 -3K8Q 4.3 PNPH_HUMAN
31 PsiBlast_CBE 96.7099%-133 - C5 -3GGS - PNPH_HUMAN
16 PsiBlast_PDB 96.6699%-135 - C5 -3GGS 4.0 PNPH_HUMAN
33 PsiBlast_CBE 96.6399%-138 - C5 -3GB9 3.9 PNPH_HUMAN
41 PsiBlast_CBE 96.6199%-131 - C5 -2ON6 5.2 PNPH_HUMAN
18 PsiBlast_PDB 96.6099%-131 - C5 -1RCT 5.2 PNPH_HUMAN
2 PsiBlast_PDB 96.5799%-129 - C5 -1RR6 5.3 PNPH_HUMAN
8 PsiBlast_PDB 96.4899%-123 - C5 -3BGS 4.7 PNPH_HUMAN
4 PsiBlast_PDB 96.4899%-128 - C5 -1RT9 5.6 PNPH_HUMAN
3 PsiBlast_PDB 96.4899%-128 - C5 -1RSZ 4.9 PNPH_HUMAN
13 PsiBlast_PDB 96.3799%-124 - C5 -3INY 3.9 PNPH_HUMAN
53 PsiBlast_CBE 96.2298%-131 - C5 -4EB8 5.5 PNPH_HUMAN
42 PsiBlast_CBE 96.1999%-128 - C5 -2A0X 4.3 PNPH_HUMAN
40 PsiBlast_CBE 96.1499%-130 - C5 -2A0Y 4.6 PNPH_HUMAN
34 PsiBlast_CBE 96.1199%-138 - C5 -3GB9 3.8 PNPH_HUMAN
5 PsiBlast_PDB 96.0999%-127 - C5 -1YRY 3.5 PNPH_HUMAN
44 PsiBlast_CBE 96.0799%-128 - C5 -2A0W 4.6 PNPH_HUMAN
39 PsiBlast_CBE 96.0199%-129 - C5 -2OC4 4.9 PNPH_HUMAN
54 PsiBlast_CBE 95.8798%-132 - C5 -4EB8 5.0 PNPH_HUMAN
38 PsiBlast_CBE 95.8499%-126 - C5 -1PWY 4.1 PNPH_HUMAN
7 PsiBlast_PDB 95.7699%-124 - C5 -1ULB 3.6 PNPH_HUMAN
20 PsiBlast_PDB 95.7499%-125 - C5 -1V3Q 4.6 PNPH_HUMAN
43 PsiBlast_CBE 95.7399%-127 - C5 -2OC9 5.5 PNPH_HUMAN
37 PsiBlast_CBE 95.6399%-128 - C5 -1RFG 4.8 PNPH_HUMAN
55 PsiBlast_CBE 95.5798%-128 - C5 -4EB8 5.5 PNPH_HUMAN
9 PsiBlast_PDB 95.0499%-123 - C5 -2Q7O 4.4 PNPH_HUMAN
73 HHSearch 92.7388%-128 * C5 *3FUC 4.4 PNPH_BOVIN
77 HHSearch 83.7355%-118 - C5 -2P4S 5.3 ?
76 HHSearch 79.5848%-121 - C5 -1TCV 2.8 ?
83 HHSearch 78.6048%-128 - C5 -4LNA 4.1 ?
79 HHSearch 75.2746%-116 - C5 -4NSN 3.4 ?
80 HHSearch 74.8841%-117 - C5 -3ODG 4.1 ?
78 HHSearch 69.9138%-119 - C5 -1G2O 5.7 PUNA_MYCTU