@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF01048_PUNA_M: (2014-09-19 )
MADPRPDPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQAELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNLTARSPLVGGEFVDLTDAYSPRLRELARQSDPQLAEGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGEPLSHAEVLAAGAASATRMGALLADVIARF

Atome Classification :

(30 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IMH_H_8(1G2O)
PUNA_MYCTU
[Raw transfer]




GNG_A_4(3IOM)
PUNA_MYCTU
[Raw transfer]




P1G_A_5(2AI1)
PNPH_BOVIN
[Raw transfer]




IMH_G_7(1G2O)
PUNA_MYCTU
[Raw transfer]




GNG_B_6(3IOM)
PUNA_MYCTU
[Raw transfer]




DIH_H_8(1N3I)
PUNA_MYCTU
[Raw transfer]




DIH_I_9(1N3I)
PUNA_MYCTU
[Raw transfer]




DIH_G_7(1N3I)
PUNA_MYCTU
[Raw transfer]




IMH_I_9(1G2O)
PUNA_MYCTU
[Raw transfer]




P1D_A_5(2AI2)
PNPH_BOVIN
[Raw transfer]




IMG_A_4(1B8N)
PNPH_BOVIN
[Raw transfer]




IMR_H_8(1I80)
PUNA_MYCTU
[Raw transfer]




DIH_A_8(2P4S)
?
[Raw transfer]




9HX_G_7(1I80)
PUNA_MYCTU
[Raw transfer]




IMH_A_4(1B8O)
PNPH_BOVIN
[Raw transfer]




HPA_A_3(3SCZ)
PUNA_MYCTU
[Raw transfer]




HPA_B_4(3SCZ)
PUNA_MYCTU
[Raw transfer]




9HX_E_5(1I80)
PUNA_MYCTU
[Raw transfer]




9HX_F_6(1I80)
PUNA_MYCTU
[Raw transfer]




HA1_A_4(1V48)
PNPH_BOVIN
[Raw transfer]




9DG_A_5(3FUC)
PNPH_BOVIN
[Raw transfer]




HPA_G_7(1A9R)
PNPH_BOVIN
[Raw transfer]




HPA_G_7(1A9Q)
PNPH_BOVIN
[Raw transfer]




HPA_A_4(1VFN)
PNPH_BOVIN
[Raw transfer]




HPA_G_7(1A9T)
PNPH_BOVIN
[Raw transfer]




ADE_A_4(4NSN)
?
[Raw transfer]




8IG_A_10(1C3X)
PUNA_CELSP
[Raw transfer]




ADE_A_4(4LNA)
?
[Raw transfer]




XAN_A_2(3ODG)
?
[Raw transfer]




BTY_A_4(2QPL)
PNPH_BOVIN
[Raw transfer]




R1P_D_4(1A9T)
PNPH_BOVIN
[Raw transfer]




9D9_A_4(3FUC)
PNPH_BOVIN
[Raw transfer]




9D9_A_4(3FUC)
PNPH_BOVIN
[Raw transfer]




NDS_G_7(1TCV)
?
[Raw transfer]




MPD_A_5(4LNA)
?
[Raw transfer]




2 PsiBlast_PDB 99.03100%-120 - C7 -1I80 3.3 PUNA_MYCTU
22 PsiBlast_CBE 98.72100%-122 - C7 -3IOM 5.6 PUNA_MYCTU
5 PsiBlast_PDB 98.67100%-120 - C7 -3SCZ 3.6 PUNA_MYCTU
26 PsiBlast_CBE 98.45100%-122 - C7 -1I80 3.4 PUNA_MYCTU
21 PsiBlast_CBE 98.27100%-120 - C7 -3SCZ 3.6 PUNA_MYCTU
4 PsiBlast_PDB 98.20100%-121 - C7 -3IOM 5.4 PUNA_MYCTU
25 PsiBlast_CBE 97.73100%-122 - C7 -1I80 3.3 PUNA_MYCTU
23 PsiBlast_CBE 97.56100%-120 - C7 -1N3I 5.6 PUNA_MYCTU
27 PsiBlast_CBE 97.47100%-119 - C7 -1G2O 5.9 PUNA_MYCTU
28 PsiBlast_CBE 97.39100%-116 - C7 -1G2O 5.9 PUNA_MYCTU
24 PsiBlast_CBE 97.21100%-117 - C7 -1N3I 5.5 PUNA_MYCTU
3 PsiBlast_PDB 97.08100%-116 - C7 -1N3I 5.6 PUNA_MYCTU
39 HHSearch 96.63100%-118 - C7 -1G2O 6.1 PUNA_MYCTU
6 PsiBlast_PDB 80.3256%-101 - C7 -1C3X 4.5 PUNA_CELSP
44 HHSearch 77.4836%-112 - C7 -3ODG 3.2 ?
45 HHSearch 75.1636%-111 - C7 -4NSN 3.5 ?
50 HHSearch 74.8335%-109 - C7 -4LNA 3.3 ?
40 HHSearch 74.2539%-112 * C7 *3FUC 4.3 PNPH_BOVIN
46 HHSearch 74.1934%-108 - C7 -2P4S 5.0 ?
11 PsiBlast_PDB 73.8035%-106 - C7 -1B8O 6.1 PNPH_BOVIN
10 PsiBlast_PDB 73.7935%-109 - C7 -1B8N 6.2 PNPH_BOVIN
9 PsiBlast_PDB 73.1535%-106 - C7 -1A9R 3.3 PNPH_BOVIN
8 PsiBlast_PDB 72.8835%-104 - C7 -1A9Q 3.1 PNPH_BOVIN
17 PsiBlast_PDB 72.3735%-104 - C7 -1A9T 4.7 PNPH_BOVIN
43 HHSearch 72.3035%-118 - C7 -1TCV 2.8 ?
19 PsiBlast_PDB 72.2035%-113 - C7 -2AI1 8.5 PNPH_BOVIN
14 PsiBlast_PDB 71.6835%-116 - C7 -2QPL 3.5 PNPH_BOVIN
20 PsiBlast_PDB 71.6535%-107 - C7 -2AI2 7.8 PNPH_BOVIN
13 PsiBlast_PDB 70.7235%-109 - C7 -1VFN 3.1 PNPH_BOVIN
18 PsiBlast_PDB 68.8335%-117 - C7 -1V48 7.2 PNPH_BOVIN