Study : PF01471_MMP12_RABIT (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C2_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C2_S1
Complex: PGR_A_10(4EFS) / Model_58(4EFS/A) = [3.2] Download363.102.30MKFLLLILTLWVTSSGADPLKENDMLFAENYLENFYGLKVERIPMTKMKTNRNFIEEKVQEMQQFLGLNVTGQLDTSTLEMMHKPRCGVPDVYHFKTMPGRPVWRKHYITYRIKNYTPDMKREDVEYAIQKAFQVWSDVTPLKFRKITTGKADIMILFASGAHGDYGAFDGRGGVIAHAFGPGPGIGGDTHFDEDEIWSKSYKGTNLFLVAVHELGHALGLDHSNDPKAIMFPTYGYIDLNTFHLSADDIRGIQSLYGGPEQHQPMPKPDNPEPTACDHNLKFDAVTTVGNKIFFFKDSFFWWKIPKSSTTSVRLISSLWPTLPSGIEAAYEIGDRHQVFLFKGDKFWLISHLRLQPNYPKSIHSLGFPDFVKKIDAAVFNPSLRKTYFFVDNLYWRYDERREVMDAGYPKLITKHFPGIGPKIDAVFYFQRYYYFFQGPNQLEYDTFSSRVTKKLKSNSWFDC
Complex: PGO_A_10(4H76) / Model_49(4H76/A) = [3.3] Download425.3830.12MKFLLLILTLWVTSSGADPLKENDMLFAENYLENFYGLKVERIPMTKMKTNRNFIEEKVQEMQQFLGLNVTGQLDTSTLEMMHKPRCGVPDVYHFKTMPGRPVWRKHYITYRIKNYTPDMKREDVEYAIQKAFQVWSDVTPLKFRKITTGKADIMILFASGAHGDYGAFDGRGGVIAHAFGPGPGIGGDTHFDEDEIWSKSYKGTNLFLVAVHELGHALGLDHSNDPKAIMFPTYGYIDLNTFHLSADDIRGIQSLYGGPEQHQPMPKPDNPEPTACDHNLKFDAVTTVGNKIFFFKDSFFWWKIPKSSTTSVRLISSLWPTLPSGIEAAYEIGDRHQVFLFKGDKFWLISHLRLQPNYPKSIHSLGFPDFVKKIDAAVFNPSLRKTYFFVDNLYWRYDERREVMDAGYPKLITKHFPGIGPKIDAVFYFQRYYYFFQGPNQLEYDTFSSRVTKKLKSNSWFDC
Complex: GLY_A_8(3LIR) / Model_62(3LIR/A) = [3.4] Download5366.9124.63MKFLLLILTLWVTSSGADPLKENDMLFAENYLENFYGLKVERIPMTKMKTNRNFIEEKVQEMQQFLGLNVTGQLDTSTLEMMHKPRCGVPDVYHFKTMPGRPVWRKHYITYRIKNYTPDMKREDVEYAIQKAFQVWSDVTPLKFRKITTGKADIMILFASGAHGDYGAFDGRGGVIAHAFGPGPGIGGDTHFDEDEIWSKSYKGTNLFLVAVHELGHALGLDHSNDPKAIMFPTYGYIDLNTFHLSADDIRGIQSLYGGPEQHQPMPKPDNPEPTACDHNLKFDAVTTVGNKIFFFKDSFFWWKIPKSSTTSVRLISSLWPTLPSGIEAAYEIGDRHQVFLFKGDKFWLISHLRLQPNYPKSIHSLGFPDFVKKIDAAVFNPSLRKTYFFVDNLYWRYDERREVMDAGYPKLITKHFPGIGPKIDAVFYFQRYYYFFQGPNQLEYDTFSSRVTKKLKSNSWFDC
Complex: PF3_A_4(1UTZ) / Model_17(1UTZ/A) = [3.6] Download1044.3426.00MKFLLLILTLWVTSSGADPLKENDMLFAENYLENFYGLKVERIPMTKMKTNRNFIEEKVQEMQQFLGLNVTGQLDTSTLEMMHKPRCGVPDVYHFKTMPGRPVWRKHYITYRIKNYTPDMKREDVEYAIQKAFQVWSDVTPLKFRKITTGKADIMILFASGAHGDYGAFDGRGGVIAHAFGPGPGIGGDTHFDEDEIWSKSYKGTNLFLVAVHELGHALGLDHSNDPKAIMFPTYGYIDLNTFHLSADDIRGIQSLYGGPEQHQPMPKPDNPEPTACDHNLKFDAVTTVGNKIFFFKDSFFWWKIPKSSTTSVRLISSLWPTLPSGIEAAYEIGDRHQVFLFKGDKFWLISHLRLQPNYPKSIHSLGFPDFVKKIDAAVFNPSLRKTYFFVDNLYWRYDERREVMDAGYPKLITKHFPGIGPKIDAVFYFQRYYYFFQGPNQLEYDTFSSRVTKKLKSNSWFDC
Complex: PGO_B_(4H84) / Model_47(4H84/B) = [3.6] Download913.1326.82MKFLLLILTLWVTSSGADPLKENDMLFAENYLENFYGLKVERIPMTKMKTNRNFIEEKVQEMQQFLGLNVTGQLDTSTLEMMHKPRCGVPDVYHFKTMPGRPVWRKHYITYRIKNYTPDMKREDVEYAIQKAFQVWSDVTPLKFRKITTGKADIMILFASGAHGDYGAFDGRGGVIAHAFGPGPGIGGDTHFDEDEIWSKSYKGTNLFLVAVHELGHALGLDHSNDPKAIMFPTYGYIDLNTFHLSADDIRGIQSLYGGPEQHQPMPKPDNPEPTACDHNLKFDAVTTVGNKIFFFKDSFFWWKIPKSSTTSVRLISSLWPTLPSGIEAAYEIGDRHQVFLFKGDKFWLISHLRLQPNYPKSIHSLGFPDFVKKIDAAVFNPSLRKTYFFVDNLYWRYDERREVMDAGYPKLITKHFPGIGPKIDAVFYFQRYYYFFQGPNQLEYDTFSSRVTKKLKSNSWFDC
Consensus
[pKd Mean = 3.42]
-1622
(s=1890)
21
(s=10)
MKFLLLILTLWVTSSGADPLKENDMLFAENYLENFYGLKVERIPMTKMKTNRNFIEEKVQEMQQFLGLNVTGQLDTSTLEMMHKPRCGVPDVYHFKTMPGRPVWRKHYITYRIKNYTPDMKREDVEYAIQKAFQVWSDVTPLKFRKITTGKADIMILFASGAHGDYGAFDGRGGVIAHAFGPGPGIGGDTHFDEDEIWSKSYKGTNLFLVAVHELGHALGLDHSNDPKAIMFPTYGYIDLNTFHLSADDIRGIQSLYGGPEQHQPMPKPDNPEPTACDHNLKFDAVTTVGNKIFFFKDSFFWWKIPKSSTTSVRLISSLWPTLPSGIEAAYEIGDRHQVFLFKGDKFWLISHLRLQPNYPKSIHSLGFPDFVKKIDAAVFNPSLRKTYFFVDNLYWRYDERREVMDAGYPKLITKHFPGIGPKIDAVFYFQRYYYFFQGPNQLEYDTFSSRVTKKLKSNSWFDC