@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF01471_MMP12_: (2014-09-24 )
MKFLLLILTLWVTSSGADPLKENDMLFAENYLENFYGLKVERIPMTKMKTNRNFIEEKVQEMQQFLGLNVTGQLDTSTLEMMHKPRCGVPDVYHFKTMPGRPVWRKHYITYRIKNYTPDMKREDVEYAIQKAFQVWSDVTPLKFRKITTGKADIMILFASGAHGDYGAFDGRGGVIAHAFGPGPGIGGDTHFDEDEIWSKSYKGTNLFLVAVHELGHALGLDHSNDPKAIMFPTYGYIDLNTFHLSADDIRGIQSLYGGPEQHQPMPKPDNPEPTACDHNLKFDAVTTVGNKIFFFKDSFFWWKIPKSSTTSVRLISSLWPTLPSGIEAAYEIGDRHQVFLFKGDKFWLISHLRLQPNYPKSIHSLGFPDFVKKIDAAVFNPSLRKTYFFVDNLYWRYDERREVMDAGYPKLITKHFPGIGPKIDAVFYFQRYYYFFQGPNQLEYDTFSSRVTKKLKSNSWFDC

Atome Classification :

(54 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IMD_B_(3UVC)
MMP12_HUMAN
[Raw transfer]




D3X_A_7(3N2U)
MMP12_HUMAN
[Raw transfer]




JT5_A_7(3N2V)
MMP12_HUMAN
[Raw transfer]




10B_A_7(4H76)
MMP12_HUMAN
[Raw transfer]




KLJ_A_7(4GUY)
MMP12_HUMAN
[Raw transfer]




KLH_A_7(3RTT)
MMP12_HUMAN
[Raw transfer]




KLG_A_7(3RTS)
MMP12_HUMAN
[Raw transfer]




0XX_A_9(4H1Q)
MMP9_HUMAN
[Raw transfer]




NHK_A_7(3NX7)
MMP12_HUMAN
[Raw transfer]




L29_B_14(4H49)
MMP12_HUMAN
[Raw transfer]




NGH_A_7(1RMZ)
MMP12_HUMAN
[Raw transfer]




BSI_A_6(1I76)
MMP8_HUMAN
[Raw transfer]




E37_A_7(4EFS)
MMP12_HUMAN
[Raw transfer]




023_B_14(2WOA)
MMP12_HUMAN
[Raw transfer]




CGS_B_14(1JIZ)
MMP12_HUMAN
[Raw transfer]




L29_B_14(4H49)
MMP12_HUMAN
[Raw transfer]




CGS_A_13(1JIZ)
MMP12_HUMAN
[Raw transfer]




023_B_12(2WO9)
MMP12_HUMAN
[Raw transfer]




576_A_10(2WOA)
MMP12_HUMAN
[Raw transfer]




077_C_20(2WO8)
MMP12_HUMAN
[Raw transfer]




HTA_A_8(1FBL)
MMP1_PIG
[Raw transfer]




DEO_B_14(1ROS)
MMP12_HUMAN
[Raw transfer]




068_A_8(2WO9)
MMP12_HUMAN
[Raw transfer]




023_D_22(2WO8)
MMP12_HUMAN
[Raw transfer]




Y38_A_8(4H84)
MMP12_HUMAN
[Raw transfer]




023_B_11(2WO8)
MMP12_HUMAN
[Raw transfer]




EEG_A_7(3TS4)
MMP12_HUMAN
[Raw transfer]




DEO_A_13(1ROS)
MMP12_HUMAN
[Raw transfer]




0D2_A_16(3UVC)
MMP12_HUMAN
[Raw transfer]




576_C_25(2WOA)
MMP12_HUMAN
[Raw transfer]




37A_A_7(2HU6)
MMP12_HUMAN
[Raw transfer]




M4S_A_8(3LKA)
MMP12_HUMAN
[Raw transfer]




GOL_B_21(4H49)
MMP12_HUMAN
[Raw transfer]




068_C_24(2WO9)
MMP12_HUMAN
[Raw transfer]




GOL_B_20(4H30)
MMP12_HUMAN
[Raw transfer]




0ZD_B_19(4H30)
MMP12_HUMAN
[Raw transfer]




R45_A_7(4GR3)
MMP12_HUMAN
[Raw transfer]




R4B_A_7(4GR0)
MMP12_HUMAN
[Raw transfer]




BAT_A_7(1JK3)
MMP12_HUMAN
[Raw transfer]




GOL_A_10(4H30)
MMP12_HUMAN
[Raw transfer]




CP8_A_3(1UTT)
MMP12_HUMAN
[Raw transfer]




QEG_A_7(3TSK)
MMP12_HUMAN
[Raw transfer]




BAT_A_6(1RM8)
MMP16_HUMAN
[Raw transfer]




EEF_A_8(3LJG)
MMP12_HUMAN
[Raw transfer]




PF3_A_3(1UTZ)
MMP12_HUMAN
[Raw transfer]




GOL_A_8(4EFS)
MMP12_HUMAN
[Raw transfer]




GOL_A_9(3TS4)
MMP12_HUMAN
[Raw transfer]




0ZD_B_19(4H30)
MMP12_HUMAN
[Raw transfer]




EEA_A_7(3LIL)
MMP12_HUMAN
[Raw transfer]




EEG_A_7(3LIK)
MMP12_HUMAN
[Raw transfer]




EEC_A_7(3LIR)
MMP12_HUMAN
[Raw transfer]




GOL_A_12(4H84)
MMP12_HUMAN
[Raw transfer]




HAE_A_7(3LKA)
MMP12_HUMAN
[Raw transfer]




HAE_A_8(3LIK)
MMP12_HUMAN
[Raw transfer]




HAE_A_5(1UTZ)
MMP12_HUMAN
[Raw transfer]




HAE_A_8(3LIL)
MMP12_HUMAN
[Raw transfer]




HAE_A_2(1UTT)
MMP12_HUMAN
[Raw transfer]




HAE_B_11(1UTZ)
MMP12_HUMAN
[Raw transfer]




HAE_A_8(2HU6)
MMP12_HUMAN
[Raw transfer]




EDO_A_17(3UVC)
MMP12_HUMAN
[Raw transfer]




PGO_A_11(4EFS)
MMP12_HUMAN
[Raw transfer]




GLY_A_8(3LIR)
MMP12_HUMAN
[Raw transfer]




IMD_B_(3UVC)
MMP12_HUMAN
[Raw transfer]




PGO_A_18(4FVL)
?
[Raw transfer]




HAE_A_7(3LJG)
MMP12_HUMAN
[Raw transfer]




PF3_A_4(1UTZ)
MMP12_HUMAN
[Raw transfer]




PGR_A_10(4H84)
MMP12_HUMAN
[Raw transfer]




CHAIN_X_2(2OXW)
MMP12_HUMAN
[Raw transfer]

-

0D2_A_16(3UVC)
MMP12_HUMAN
[Raw transfer]




PGR_A_10(4EFS)
MMP12_HUMAN
[Raw transfer]




PEG_A_11(4H76)
MMP12_HUMAN
[Raw transfer]




PEG_A_14(4H84)
MMP12_HUMAN
[Raw transfer]




IMD_A_13(4EFS)
MMP12_HUMAN
[Raw transfer]




PEG_B_20(4H49)
MMP12_HUMAN
[Raw transfer]




IMD_A_8(3TS4)
MMP12_HUMAN
[Raw transfer]




CHAIN_X_3(2OXZ)
MMP12_HUMAN
[Raw transfer]

-

PGO_B_(4H84)
MMP12_HUMAN
[Raw transfer]




PF3_A_3(1UTZ)
MMP12_HUMAN
[Raw transfer]




CHAIN_B_2(4IN9)
?
[Raw transfer]

-

PEG_B_22(4H30)
MMP12_HUMAN
[Raw transfer]




PEG_A_14(4H84)
MMP12_HUMAN
[Raw transfer]




P6G_A_10(3LIK)
MMP12_HUMAN
[Raw transfer]




Y38_A_8(4H84)
MMP12_HUMAN
[Raw transfer]




Y38_B_21(4H84)
MMP12_HUMAN
[Raw transfer]




CHAIN_B_2(3AYU)
MMP2_HUMAN
[Raw transfer]

-

PGO_A_10(4H76)
MMP12_HUMAN
[Raw transfer]




CHAIN_C_3(4FVL)
?
[Raw transfer]

-

CHAIN_W_5(4G0D)
MMP13_HUMAN
[Raw transfer]

-

PEG_B_22(4H30)
MMP12_HUMAN
[Raw transfer]




PGO_B_(4H84)
MMP12_HUMAN
[Raw transfer]




8 PsiBlast_PDB 82.3448%-113 - C2 -4G0D 9.3 MMP13_HUMAN
3 PsiBlast_PDB 82.0851%-113 - C2 -1FBL 5.0 MMP1_PIG
7 PsiBlast_PDB 81.1148%-114 - C2 -4FVL 10.2 ?
9 PsiBlast_PDB 51.6876%-107 - C2 -1JIZ 5.5 MMP12_HUMAN
21 PsiBlast_CBE 51.4276%-108 - C2 -1JIZ 5.6 MMP12_HUMAN
29 PsiBlast_CBE 51.1375%-110 - C2 -2WO8 6.7 MMP12_HUMAN
56 PsiBlast_CBE 51.0777%-111 - C2 -4GR3 8.4 MMP12_HUMAN
43 PsiBlast_CBE 50.9475%-111 - C2 -3UVC 2.8 MMP12_HUMAN
23 PsiBlast_CBE 50.8375%-107 - C2 -2WOA 6.1 MMP12_HUMAN
60 PsiBlast_CBE 50.7977%-111 - C2 -3TS4 7.7 MMP12_HUMAN
77 PsiBlast_CBE 50.7877%-108 - C2 -3LKA 4.3 MMP12_HUMAN
61 PsiBlast_CBE 50.7877%-110 - C2 -3LJG 8.8 MMP12_HUMAN
20 PsiBlast_PDB 50.7877%-111 - C2 -1RMZ 5.0 MMP12_HUMAN
17 PsiBlast_PDB 50.7077%-111 - C2 -1UTZ 8.3 MMP12_HUMAN
12 PsiBlast_PDB 50.6875%-106 - C2 -2WOA 6.6 MMP12_HUMAN
47 PsiBlast_CBE 50.6077%-110 - C2 -4H84 3.6 MMP12_HUMAN
63 PsiBlast_CBE 50.5477%-108 - C2 -3LIL 9.3 MMP12_HUMAN
26 PsiBlast_CBE 50.5175%-106 - C2 -2WO9 7.7 MMP12_HUMAN
30 PsiBlast_CBE 50.4975%-107 - C2 -2WO8 7.7 MMP12_HUMAN
68 PsiBlast_CBE 50.4677%-109 - C2 -2HU6 7.2 MMP12_HUMAN
24 PsiBlast_CBE 50.4275%-107 - C2 -2WOA 7.7 MMP12_HUMAN
11 PsiBlast_PDB 50.3775%-105 - C2 -2WO9 7.8 MMP12_HUMAN
42 PsiBlast_CBE 50.3577%-107 - C2 -1UTZ 4.6 MMP12_HUMAN
49 PsiBlast_CBE 50.3477%-110 - C2 -4H76 7.3 MMP12_HUMAN
71 PsiBlast_CBE 50.2977%-108 - C2 -4GUY 5.4 MMP12_HUMAN
65 PsiBlast_CBE 50.2477%-108 - C2 -2OXZ 4.3 MMP12_HUMAN
57 PsiBlast_CBE 50.1977%-112 - C2 -4GR0 10.1 MMP12_HUMAN
52 PsiBlast_CBE 50.1777%-108 - C2 -4H49 7.5 MMP12_HUMAN
48 PsiBlast_CBE 50.1677%-108 - C2 -4H84 7.6 MMP12_HUMAN
74 PsiBlast_CBE 50.1077%-106 - C2 -3NX7 5.0 MMP12_HUMAN
53 PsiBlast_CBE 50.1077%-106 - C2 -4H49 7.6 MMP12_HUMAN
31 PsiBlast_CBE 50.0575%-110 - C2 -1ROS 7.8 MMP12_HUMAN
76 PsiBlast_CBE 50.0477%-105 - C2 -3N2U 5.0 MMP12_HUMAN
72 PsiBlast_CBE 49.9977%-104 - C2 -3RTT 5.7 MMP12_HUMAN
16 PsiBlast_PDB 49.9977%-107 - C2 -1UTT 7.6 MMP12_HUMAN
55 PsiBlast_CBE 49.9777%-106 - C2 -4H30 7.2 MMP12_HUMAN
59 PsiBlast_CBE 49.9677%-110 - C2 -3TSK 9.5 MMP12_HUMAN
13 PsiBlast_PDB 49.9675%-107 - C2 -1ROS 7.9 MMP12_HUMAN
27 PsiBlast_CBE 49.9475%-105 - C2 -2WO9 7.7 MMP12_HUMAN
75 PsiBlast_CBE 49.8077%-107 - C2 -3N2V 6.4 MMP12_HUMAN
66 PsiBlast_CBE 49.7577%-106 - C2 -2OXW 2.8 MMP12_HUMAN
73 PsiBlast_CBE 49.7177%-105 - C2 -3RTS 5.0 MMP12_HUMAN
64 PsiBlast_CBE 49.6877%-106 - C2 -3LIK 8.8 MMP12_HUMAN
58 PsiBlast_CBE 49.6777%-107 - C2 -4EFS 7.7 MMP12_HUMAN
69 PsiBlast_CBE 49.6377%-106 - C2 -1JK3 6.4 MMP12_HUMAN
28 PsiBlast_CBE 49.4375%-105 - C2 -2WO8 7.6 MMP12_HUMAN
54 PsiBlast_CBE 49.4277%-105 - C2 -4H30 7.8 MMP12_HUMAN
62 PsiBlast_CBE 49.1277%-103 - C2 -3LIR 7.5 MMP12_HUMAN
19 PsiBlast_PDB 49.0575%-105 - C2 -3UVC 5.4 MMP12_HUMAN
108 HHSearch 46.1056% -92 - C2 -3AYU 9.5 MMP2_HUMAN
105 HHSearch 45.5956% -99 - C2 -1RM8 6.3 MMP16_HUMAN
102 HHSearch 44.7551% -92 - C2 -1I76 7.3 MMP8_HUMAN
104 HHSearch 43.3150% -91 * C2 *4H1Q 8.6 MMP9_HUMAN
111 HHSearch 40.1642% -89 - C2 -4IN9 6.1 ?