@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF02540_NADE_B: (2014-09-30 )
MSMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQLAVESIREEGGDAQFIAVRLPHGTQQDEDDAQLALKFIKPDKSWKFDIKSTVSAFSDQYQQETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK

Atome Classification :

(19 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADJ_B_19(1KQP)
NADE_BACSU
[Raw transfer]




NAD_B_10(2NSY)
NADE_BACSU
[Raw transfer]




NAD_A_8(2NSY)
NADE_BACSU
[Raw transfer]




DND_A_4(1EE1)
NADE_BACSU
[Raw transfer]




APC_A_6(1IH8)
NADE_BACSU
[Raw transfer]




APC_B_6(2PZ8)
NADE_BACAN
[Raw transfer]




APC_A_5(2PZ8)
NADE_BACAN
[Raw transfer]




AMP_A_9(1NSY)
NADE_BACSU
[Raw transfer]




AMP_B_9(2NSY)
NADE_BACSU
[Raw transfer]




AMP_A_4(1FYD)
NADE_BACSU
[Raw transfer]




AMP_A_7(2NSY)
NADE_BACSU
[Raw transfer]




DND_B_5(1EE1)
NADE_BACSU
[Raw transfer]




ATP_A_6(1EE1)
NADE_BACSU
[Raw transfer]




DND_C_3(1IFX)
NADE_BACSU
[Raw transfer]




AMP_B_7(1NSY)
NADE_BACSU
[Raw transfer]




AMP_B_7(2PZA)
NADE_BACAN
[Raw transfer]




ATP_B_5(1NSY)
NADE_BACSU
[Raw transfer]




AMP_A_8(2PZA)
NADE_BACAN
[Raw transfer]




AMP_A_7(3FIU)
?
[Raw transfer]




POP_B_9(2PZA)
NADE_BACAN
[Raw transfer]




POP_A_12(2NSY)
NADE_BACSU
[Raw transfer]




POP_B_8(1NSY)
NADE_BACSU
[Raw transfer]




POP_B_11(2NSY)
NADE_BACSU
[Raw transfer]




POP_A_10(2PZA)
NADE_BACAN
[Raw transfer]




POP_B_21(1KQP)
NADE_BACSU
[Raw transfer]




NAD_B_2(1WXH)
NADE_ECOLI
[Raw transfer]




POP_A_10(1NSY)
NADE_BACSU
[Raw transfer]




POP_A_5(1FYD)
NADE_BACSU
[Raw transfer]




AMP_A_4(1WXI)
NADE_ECOLI
[Raw transfer]




AMP_A_3(1WXE)
NADE_ECOLI
[Raw transfer]




POP_A_8(3FIU)
?
[Raw transfer]




DPO_A_6(1WXI)
NADE_ECOLI
[Raw transfer]




19 PsiBlast_CBE 96.84100% -51 - C2 -1KQP 8.6 NADE_BACSU
4 PsiBlast_PDB 95.99100% -56 - C2 -1FYD 4.3 NADE_BACSU
17 PsiBlast_CBE 95.97100% -53 - C2 -2NSY 6.2 NADE_BACSU
2 PsiBlast_PDB 95.78100% -54 - C2 -2NSY 7.2 NADE_BACSU
1 PsiBlast_PDB 95.67100% -56 - C2 -1NSY 4.7 NADE_BACSU
6 PsiBlast_PDB 95.64100% -51 - C2 -1IH8 6.4 NADE_BACSU
18 PsiBlast_CBE 95.61100% -57 - C2 -1NSY 4.6 NADE_BACSU
3 PsiBlast_PDB 94.91100% -50 - C2 -1EE1 7.1 NADE_BACSU
22 PsiBlast_CBE 93.79100% -74 - C2 -1EE1 5.8 NADE_BACSU
21 PsiBlast_CBE 92.86100% -79 - C2 -1IFX 6.0 NADE_BACSU
5 PsiBlast_PDB 92.19100% -73 - C2 -1IFX - NADE_BACSU
24 PsiBlast_CBE 89.7277% -49 - C2 -2PZA 4.1 NADE_BACAN
25 PsiBlast_CBE 89.5277% -50 - C2 -2PZ8 7.1 NADE_BACAN
7 PsiBlast_PDB 89.5077% -47 - C2 -2PZ8 7.2 NADE_BACAN
8 PsiBlast_PDB 88.5977% -47 - C2 -2PZA 4.4 NADE_BACAN
37 HHSearch 81.6454% -62 - C2 -1WXI 3.9 NADE_ECOLI
9 PsiBlast_PDB 81.4854% -64 - C2 -1WXE 3.5 NADE_ECOLI
12 PsiBlast_PDB 80.4354% -61 - C2 -1WXH 6.7 NADE_ECOLI
40 HHSearch 66.0838% -33 - C2 -3FIU 4.3 ?