@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF04151_AMPX_VIBPR: (2014-10-08 )
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATGDTPTPGNQ

Atome Classification :

(16 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PLU_A_5(1FT7)
AMPX_VIBPR
[Raw transfer]




BES_A_4(1XRY)
AMPX_VIBPR
[Raw transfer]




BES_A_4(1TXR)
AMPX_VIBPR
[Raw transfer]




PLU_A_8(3B7I)
AMPX_VIBPR
[Raw transfer]




LEU_A_7(3B3W)
AMPX_VIBPR
[Raw transfer]




ILE_A_9(3B3T)
AMPX_VIBPR
[Raw transfer]




PLU_A_12(3B3C)
AMPX_VIBPR
[Raw transfer]




HQY_A_4(3VH9)
AMPX_VIBPR
[Raw transfer]




TRS_A_4(2PRQ)
AMPX_VIBPR
[Raw transfer]




VAL_A_9(3B3V)
AMPX_VIBPR
[Raw transfer]




LEU_A_14(3B3S)
AMPX_VIBPR
[Raw transfer]




CHAIN_B_2(2IQ6)
AMPX_VIBPR
[Raw transfer]

-

TRS_A_6(1LOK)
AMPX_VIBPR
[Raw transfer]




TRS_A_4(3FH4)
AMPX_VIBPR
[Raw transfer]




CHAIN_B_2(2NYQ)
AMPX_VIBPR
[Raw transfer]

-

BUB_A_4(1CP6)
AMPX_VIBPR
[Raw transfer]




1 PsiBlast_PDB 93.13100% -67 - C1 -1TXR 4.9 AMPX_VIBPR
9 PsiBlast_PDB 91.22100% -66 - C1 -1LOK 4.2 AMPX_VIBPR
8 PsiBlast_PDB 91.05100% -68 - C1 -1FT7 2.4 AMPX_VIBPR
2 PsiBlast_PDB 89.24100% -67 - C1 -1XRY 5.1 AMPX_VIBPR
6 PsiBlast_PDB 86.65100% -66 - C1 -3VH9 3.5 AMPX_VIBPR
5 PsiBlast_PDB 80.37100% -65 - C1 -3FH4 2.8 AMPX_VIBPR
4 PsiBlast_PDB 78.36100% -66 - C1 -2NYQ 3.0 AMPX_VIBPR
7 PsiBlast_PDB 77.21100% -65 - C1 -1CP6 3.3 AMPX_VIBPR
12 PsiBlast_PDB 65.37100% -64 - C1 -2IQ6 4.6 AMPX_VIBPR
19 PsiBlast_PDB 61.0599% -64 - C1 -3B3S 2.9 AMPX_VIBPR
15 PsiBlast_PDB 60.3799% -66 - C1 -3B7I 2.4 AMPX_VIBPR
13 PsiBlast_PDB 60.0499% -64 - C1 -3B3V 3.1 AMPX_VIBPR
18 PsiBlast_PDB 51.7599% -64 * C1 *3B3C 3.3 AMPX_VIBPR
10 PsiBlast_PDB 51.38100% -63 - C1 -2PRQ 2.6 AMPX_VIBPR
14 PsiBlast_PDB 51.0199% -64 - C1 -3B3W 3.3 AMPX_VIBPR
16 PsiBlast_PDB 36.3099% -65 - C1 -3B3T 2.5 AMPX_VIBPR