@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF13733_B4GT1_BOVIN: (2014-10-20 )
MKFREPLLGGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLRRLPQLVGVHPPLQGSSHGAAAIGQPSGELRLRGVAPPPPLQNSSKPRSRAPSNLDAYSHPGPGPGPGSNLTSAPVPSTTTRSLTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS

Atome Classification :

(58 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

UD2_B_9(1OQM)
B4GT1_BOVIN
[Raw transfer]




UD2_D_10(1OQM)
B4GT1_BOVIN
[Raw transfer]




GDU_B_5(2FYC)
B4GT1_BOVIN
[Raw transfer]




GUD_D_10(1O23)
B4GT1_BOVIN
[Raw transfer]




GDU_D_6(1YRO)
B4GT1_BOVIN
[Raw transfer]




GDU_A_3(1TVY)
B4GT1_BOVIN
[Raw transfer]




GDU_B_5(1YRO)
B4GT1_BOVIN
[Raw transfer]




GDU_B_4(1O0R)
B4GT1_BOVIN
[Raw transfer]




GDU_D_6(2FYC)
B4GT1_BOVIN
[Raw transfer]




GDU_A_3(1TW1)
B4GT1_BOVIN
[Raw transfer]




GDU_B_4(1TVY)
B4GT1_BOVIN
[Raw transfer]




GDU_B_4(1TW1)
B4GT1_BOVIN
[Raw transfer]




GDU_A_3(1O0R)
B4GT1_BOVIN
[Raw transfer]




GUD_B_9(1O23)
B4GT1_BOVIN
[Raw transfer]




GOL_A_12(4EEO)
B4GT1_HUMAN
[Raw transfer]




GOL_B_15(4EE5)
B4GT1_HUMAN
[Raw transfer]




GOL_A_7(4EEA)
B4GT1_HUMAN
[Raw transfer]




GOL_A_7(4EE5)
B4GT1_HUMAN
[Raw transfer]




GOL_B_25(4EE3)
B4GT1_HUMAN
[Raw transfer]




GOL_A_7(4EEG)
B4GT1_HUMAN
[Raw transfer]




UDP_D_12(1NKH)
B4GT1_BOVIN
[Raw transfer]




UDP_B_11(1NKH)
B4GT1_BOVIN
[Raw transfer]




GOL_C_24(4EEG)
B4GT1_HUMAN
[Raw transfer]




GOL_A_14(4EE4)
B4GT1_HUMAN
[Raw transfer]




GOL_B_23(4EEM)
B4GT1_HUMAN
[Raw transfer]




GOL_B_17(4EEA)
B4GT1_HUMAN
[Raw transfer]




GOL_A_11(4EEM)
B4GT1_HUMAN
[Raw transfer]




GOL_C_25(4EE5)
B4GT1_HUMAN
[Raw transfer]




GOL_B_22(4EEO)
B4GT1_HUMAN
[Raw transfer]




GOL_B_14(4EEG)
B4GT1_HUMAN
[Raw transfer]




UDP_C_25(4EEM)
B4GT1_HUMAN
[Raw transfer]




BGC_B_5(1NF5)
B4GT1_BOVIN
[Raw transfer]




UDH_B_14(1TW5)
B4GT1_BOVIN
[Raw transfer]




UDP_B_14(4EEM)
B4GT1_HUMAN
[Raw transfer]




UDH_A_4(4KRV)
B4GT1_BOVIN
[Raw transfer]




UDP_B_13(4EE5)
B4GT1_HUMAN
[Raw transfer]




UDP_D_14(2FYD)
B4GT1_BOVIN
[Raw transfer]




UDP_C_25(4EEO)
B4GT1_HUMAN
[Raw transfer]




NGA_D_8(2FYD)
B4GT1_BOVIN
[Raw transfer]




UDP_B_13(2FYD)
B4GT1_BOVIN
[Raw transfer]




UDP_C_23(4EE5)
B4GT1_HUMAN
[Raw transfer]




UDP_B_15(4EEO)
B4GT1_HUMAN
[Raw transfer]




UDH_A_13(1TW5)
B4GT1_BOVIN
[Raw transfer]




UDP_A_5(4EEA)
B4GT1_HUMAN
[Raw transfer]




BGN_D_8(1NWG)
B4GT1_BOVIN
[Raw transfer]




UDP_B_11(1PZY)
B4GT1_BOVIN
[Raw transfer]




UDP_B_15(4EEA)
B4GT1_HUMAN
[Raw transfer]




UDH_B_16(4EE3)
B4GT1_HUMAN
[Raw transfer]




UDP_C_22(4EEG)
B4GT1_HUMAN
[Raw transfer]




UDP_B_12(4EEG)
B4GT1_HUMAN
[Raw transfer]




NAG_B_5(1PZY)
B4GT1_BOVIN
[Raw transfer]




BGN_B_7(1NWG)
B4GT1_BOVIN
[Raw transfer]




BGC_D_6(1NF5)
B4GT1_BOVIN
[Raw transfer]




UDH_C_(4EE3)
B4GT1_HUMAN
[Raw transfer]




UDP_D_12(1PZY)
B4GT1_BOVIN
[Raw transfer]




UDH_B_13(4KRV)
B4GT1_BOVIN
[Raw transfer]




UDP_A_6(4EEO)
B4GT1_HUMAN
[Raw transfer]




UDP_C_(4EEA)
B4GT1_HUMAN
[Raw transfer]




UDH_C_(3EE5)
B4GT1_HUMAN
[Raw transfer]




UDP_C_(4EE4)
B4GT1_HUMAN
[Raw transfer]




UDP_A_5(4EE5)
B4GT1_HUMAN
[Raw transfer]




NGS_A_5(4KRV)
B4GT1_BOVIN
[Raw transfer]




UDH_A_5(4EE3)
B4GT1_HUMAN
[Raw transfer]




NAG_B_5(1NMM)
B4GT1_BOVIN
[Raw transfer]




UDP_B_7(1NHE)
B4GT1_BOVIN
[Raw transfer]




UDP_B_16(4EE4)
B4GT1_HUMAN
[Raw transfer]




NAG_D_6(1NMM)
B4GT1_BOVIN
[Raw transfer]




NAG_D_6(1NQI)
B4GT1_BOVIN
[Raw transfer]




NAG_B_14(4EEO)
B4GT1_HUMAN
[Raw transfer]




NAG_B_5(1NQI)
B4GT1_BOVIN
[Raw transfer]




UDP_A_5(4EE4)
B4GT1_HUMAN
[Raw transfer]




UDP_A_5(4EEG)
B4GT1_HUMAN
[Raw transfer]




CBS_A_3(1TW5)
B4GT1_BOVIN
[Raw transfer]




UDP_A_5(4EEM)
B4GT1_HUMAN
[Raw transfer]




NAG_A_5(4EEO)
B4GT1_HUMAN
[Raw transfer]




BGC_B_5(2FYD)
B4GT1_BOVIN
[Raw transfer]




NAG_C_24(4EEO)
B4GT1_HUMAN
[Raw transfer]




NAG_D_6(1PZY)
B4GT1_BOVIN
[Raw transfer]




NGS_B_14(4KRV)
B4GT1_BOVIN
[Raw transfer]




BGC_D_6(2FYD)
B4GT1_BOVIN
[Raw transfer]




NGA_B_7(2FYD)
B4GT1_BOVIN
[Raw transfer]




CBS_B_4(1TW5)
B4GT1_BOVIN
[Raw transfer]




GDU_D_4(1FR8)
B4GT1_BOVIN
[Raw transfer]




GDU_C_3(1FR8)
B4GT1_BOVIN
[Raw transfer]




SUGAR_B_15(4EE3)
B4GT1_HUMAN
[Raw transfer]

-

U5P_C_3(1FGX)
B4GT1_BOVIN
[Raw transfer]




SUGAR_B_15(4EE4)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_A_4(4EEA)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_C_26(4EE3)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_A_4(4EE4)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_B_14(4EEA)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_A_4(4EE3)
B4GT1_HUMAN
[Raw transfer]

-

PG4_C_15(1YRO)
B4GT1_BOVIN
[Raw transfer]




PG4_C_16(2FYD)
B4GT1_BOVIN
[Raw transfer]




PG4_A_15(2FYD)
B4GT1_BOVIN
[Raw transfer]




PG4_A_13(1O23)
B4GT1_BOVIN
[Raw transfer]




PG4_A_9(1NF5)
B4GT1_BOVIN
[Raw transfer]




PG4_A_9(1NHE)
B4GT1_BOVIN
[Raw transfer]




PG4_A_15(1NKH)
B4GT1_BOVIN
[Raw transfer]




PG4_A_14(1YRO)
B4GT1_BOVIN
[Raw transfer]




PG4_C_14(1O23)
B4GT1_BOVIN
[Raw transfer]




BBV_A_4(4EEO)
B4GT1_HUMAN
[Raw transfer]




BBV_B_13(4EEO)
B4GT1_HUMAN
[Raw transfer]




BBV_C_23(4EEO)
B4GT1_HUMAN
[Raw transfer]




SUGAR_A_4(4EEG)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_C_24(4EEM)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_B_11(4EEG)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_A_4(4EEM)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_B_13(4EEM)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_A_4(4EE5)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_B_12(4EE5)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_C_22(4EE5)
B4GT1_HUMAN
[Raw transfer]

-

CBS_B_5(1TW5)
B4GT1_BOVIN
[Raw transfer]




SUGAR_C_21(4EEG)
B4GT1_HUMAN
[Raw transfer]

-

8 PsiBlast_PDB 85.01100%-101 - C1 -1OQM 7.0 B4GT1_BOVIN
24 PsiBlast_CBE 80.68100%-100 - C1 -1O23 6.4 B4GT1_BOVIN
3 PsiBlast_PDB 79.01100%-102 - C1 -1NF5 3.2 B4GT1_BOVIN
23 PsiBlast_CBE 76.86100% -99 - C1 -1OQM 7.8 B4GT1_BOVIN
4 PsiBlast_PDB 76.29100% -99 - C1 -1NKH 5.4 B4GT1_BOVIN
6 PsiBlast_PDB 73.76100% -99 - C1 -1NWG 3.8 B4GT1_BOVIN
9 PsiBlast_PDB 73.2499%-100 - C1 -1NMM 3.7 B4GT1_BOVIN
5 PsiBlast_PDB 72.92100%-100 - C1 -1NQI 3.6 B4GT1_BOVIN
31 PsiBlast_CBE 72.7599%-100 - C1 -1YRO 7.2 B4GT1_BOVIN
29 PsiBlast_CBE 72.4399% -99 * C1 *1O0R 7.4 B4GT1_BOVIN
27 PsiBlast_CBE 72.10100% -98 - C1 -1NKH 4.8 B4GT1_BOVIN
10 PsiBlast_PDB 71.0399%-103 - C1 -1O0R 7.8 B4GT1_BOVIN
7 PsiBlast_PDB 69.56100% -96 - C1 -1O23 6.8 B4GT1_BOVIN
38 PsiBlast_CBE 67.9798%-100 - C1 -2FYD 5.8 B4GT1_BOVIN
30 PsiBlast_CBE 67.7299% -99 - C1 -1NMM 3.7 B4GT1_BOVIN
11 PsiBlast_PDB 67.3699% -98 - C1 -1YRO 8.0 B4GT1_BOVIN
25 PsiBlast_CBE 66.97100%-101 - C1 -1NWG 4.2 B4GT1_BOVIN
36 PsiBlast_CBE 66.5799%-106 - C1 -1TVY 6.6 B4GT1_BOVIN
28 PsiBlast_CBE 66.06100% -98 - C1 -1NF5 2.5 B4GT1_BOVIN
34 PsiBlast_CBE 65.6699%-104 - C1 -1TW5 6.1 B4GT1_BOVIN
26 PsiBlast_CBE 64.87100% -96 - C1 -1NQI 3.6 B4GT1_BOVIN
19 PsiBlast_PDB 64.0098% -98 - C1 -2FYD 5.6 B4GT1_BOVIN
20 PsiBlast_PDB 62.7996% -98 - C1 -1NHE 4.0 B4GT1_BOVIN
22 PsiBlast_CBE 61.8499%-102 - C1 -1FGX 3.8 B4GT1_BOVIN
35 PsiBlast_CBE 61.4099%-102 - C1 -1TW1 6.4 B4GT1_BOVIN
12 PsiBlast_PDB 60.2399%-102 - C1 -1TVY 7.2 B4GT1_BOVIN
37 PsiBlast_CBE 60.2199% -99 - C1 -1PZY 4.9 B4GT1_BOVIN
15 PsiBlast_PDB 60.1599%-100 - C1 -2FYC 7.8 B4GT1_BOVIN
13 PsiBlast_PDB 58.8999% -99 - C1 -1TW1 6.8 B4GT1_BOVIN
1 PsiBlast_PDB 58.56100%-102 - C1 -1FR8 4.1 B4GT1_BOVIN
32 PsiBlast_CBE 58.1899%-100 - C1 -4KRV 7.2 B4GT1_BOVIN
17 PsiBlast_PDB 57.4699% -97 - C1 -1PZY 5.1 B4GT1_BOVIN
16 PsiBlast_PDB 56.3499%-102 - C1 -4KRV 6.8 B4GT1_BOVIN
14 PsiBlast_PDB 53.7899%-101 - C1 -1TW5 6.6 B4GT1_BOVIN
33 PsiBlast_CBE 53.4999% -98 - C1 -2FYC 7.3 B4GT1_BOVIN
58 PsiBlast_CBE 51.8789%-105 - C1 -4EE3 6.7 B4GT1_HUMAN
21 PsiBlast_CBE 50.65100% -99 - C1 -1FR8 3.1 B4GT1_BOVIN
52 PsiBlast_CBE 50.0089%-104 - C1 -4EE5 5.4 B4GT1_HUMAN
49 PsiBlast_CBE 46.3889%-103 - C1 -4EEA 5.3 B4GT1_HUMAN
43 PsiBlast_CBE 45.9989%-100 - C1 -4EEM 5.5 B4GT1_HUMAN
55 PsiBlast_CBE 44.7889%-101 - C1 -4EE4 5.1 B4GT1_HUMAN
50 PsiBlast_CBE 44.4789%-103 - C1 -4EEA 5.7 B4GT1_HUMAN
46 PsiBlast_CBE 44.1489%-103 - C1 -4EEG 5.4 B4GT1_HUMAN
57 PsiBlast_CBE 43.5189%-101 - C1 -4EE4 5.7 B4GT1_HUMAN
47 PsiBlast_CBE 41.3289%-102 - C1 -4EEG 5.7 B4GT1_HUMAN
53 PsiBlast_CBE 40.7989%-100 - C1 -4EE5 5.6 B4GT1_HUMAN
59 PsiBlast_CBE 40.7789%-100 - C1 -4EE3 6.9 B4GT1_HUMAN
61 PsiBlast_CBE 40.1589%-100 - C1 -3EE5 6.1 B4GT1_HUMAN
44 PsiBlast_CBE 39.9089%-101 - C1 -4EEM 5.9 B4GT1_HUMAN
51 PsiBlast_CBE 39.3189%-101 - C1 -4EEA 5.4 B4GT1_HUMAN
45 PsiBlast_CBE 39.2989% -99 - C1 -4EEM 5.8 B4GT1_HUMAN
40 PsiBlast_CBE 39.2889%-100 - C1 -4EEO 5.5 B4GT1_HUMAN
42 PsiBlast_CBE 39.0189%-100 - C1 -4EEO 5.9 B4GT1_HUMAN
54 PsiBlast_CBE 38.7089%-100 - C1 -4EE5 5.9 B4GT1_HUMAN
48 PsiBlast_CBE 38.1389%-100 - C1 -4EEG 5.7 B4GT1_HUMAN
56 PsiBlast_CBE 37.7089% -99 - C1 -4EE4 6.0 B4GT1_HUMAN
60 PsiBlast_CBE 37.4289% -99 - C1 -4EE3 6.5 B4GT1_HUMAN
41 PsiBlast_CBE 35.8489%-100 - C1 -4EEO 5.5 B4GT1_HUMAN