@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF13733_B4GT1_HUMAN: (2014-10-20 )
MRLREPLLSGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLSRLPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS

Atome Classification :

(56 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

UD2_B_9(1OQM)
B4GT1_BOVIN
[Raw transfer]




UD2_D_10(1OQM)
B4GT1_BOVIN
[Raw transfer]




GUD_D_10(1O23)
B4GT1_BOVIN
[Raw transfer]




GDU_B_4(1O0R)
B4GT1_BOVIN
[Raw transfer]




NAG_A_5(4EEO)
B4GT1_HUMAN
[Raw transfer]




BGC_B_5(1NF5)
B4GT1_BOVIN
[Raw transfer]




BGN_D_8(1NWG)
B4GT1_BOVIN
[Raw transfer]




BGN_B_7(1NWG)
B4GT1_BOVIN
[Raw transfer]




NAG_B_5(1NQI)
B4GT1_BOVIN
[Raw transfer]




NAG_C_24(4EEO)
B4GT1_HUMAN
[Raw transfer]




NAG_D_6(1NQI)
B4GT1_BOVIN
[Raw transfer]




NAG_B_14(4EEO)
B4GT1_HUMAN
[Raw transfer]




GOL_B_15(4EE5)
B4GT1_HUMAN
[Raw transfer]




GOL_B_17(4EEA)
B4GT1_HUMAN
[Raw transfer]




GOL_C_24(4EEG)
B4GT1_HUMAN
[Raw transfer]




GOL_B_25(4EE3)
B4GT1_HUMAN
[Raw transfer]




GOL_A_11(4EEM)
B4GT1_HUMAN
[Raw transfer]




GOL_C_25(4EE5)
B4GT1_HUMAN
[Raw transfer]




BGC_D_6(1NF5)
B4GT1_BOVIN
[Raw transfer]




GOL_A_12(4EEO)
B4GT1_HUMAN
[Raw transfer]




GOL_A_7(4EEG)
B4GT1_HUMAN
[Raw transfer]




GOL_A_14(4EE4)
B4GT1_HUMAN
[Raw transfer]




GOL_A_7(4EEA)
B4GT1_HUMAN
[Raw transfer]




GOL_B_22(4EEO)
B4GT1_HUMAN
[Raw transfer]




GOL_B_14(4EEG)
B4GT1_HUMAN
[Raw transfer]




GOL_A_14(3EE5)
B4GT1_HUMAN
[Raw transfer]




CTO_C_6(2AH9)
B4GT1_HUMAN
[Raw transfer]




GOL_B_18(3EE5)
B4GT1_HUMAN
[Raw transfer]




GOL_B_23(4EEM)
B4GT1_HUMAN
[Raw transfer]




GOL_C_(2AE7)
B4GT1_HUMAN
[Raw transfer]




GOL_A_7(4EE5)
B4GT1_HUMAN
[Raw transfer]




GUD_B_9(1O23)
B4GT1_BOVIN
[Raw transfer]




CTO_A_4(2AH9)
B4GT1_HUMAN
[Raw transfer]




CTO_B_5(2AH9)
B4GT1_HUMAN
[Raw transfer]




UDP_B_11(1NKH)
B4GT1_BOVIN
[Raw transfer]




UDP_D_12(1NKH)
B4GT1_BOVIN
[Raw transfer]




UDH_C_(4EE3)
B4GT1_HUMAN
[Raw transfer]




UDH_A_26(2AGD)
B4GT1_HUMAN
[Raw transfer]




UDP_B_15(4EEA)
B4GT1_HUMAN
[Raw transfer]




UDH_B_13(3EE5)
B4GT1_HUMAN
[Raw transfer]




UDP_C_23(4EE5)
B4GT1_HUMAN
[Raw transfer]




UDH_C_26(2AEC)
B4GT1_HUMAN
[Raw transfer]




UDH_A_23(2AES)
B4GT1_HUMAN
[Raw transfer]




UDP_A_5(4EEM)
B4GT1_HUMAN
[Raw transfer]




UDP_B_14(4EEM)
B4GT1_HUMAN
[Raw transfer]




UDH_C_26(2AE7)
B4GT1_HUMAN
[Raw transfer]




UDH_B_25(2AEC)
B4GT1_HUMAN
[Raw transfer]




UDH_C_(2AGD)
B4GT1_HUMAN
[Raw transfer]




UDP_C_22(4EEG)
B4GT1_HUMAN
[Raw transfer]




UDH_C_(4EE3)
B4GT1_HUMAN
[Raw transfer]




UDH_C_(3EE5)
B4GT1_HUMAN
[Raw transfer]




UDH_A_24(2AEC)
B4GT1_HUMAN
[Raw transfer]




UDP_C_25(4EEM)
B4GT1_HUMAN
[Raw transfer]




UDP_C_25(4EEO)
B4GT1_HUMAN
[Raw transfer]




UDP_B_15(4EEO)
B4GT1_HUMAN
[Raw transfer]




UDH_A_24(2AE7)
B4GT1_HUMAN
[Raw transfer]




UDH_C_25(2AES)
B4GT1_HUMAN
[Raw transfer]




UDH_B_25(2AE7)
B4GT1_HUMAN
[Raw transfer]




UDH_A_4(3EE5)
B4GT1_HUMAN
[Raw transfer]




UDP_B_13(4EE5)
B4GT1_HUMAN
[Raw transfer]




UDP_A_5(4EE5)
B4GT1_HUMAN
[Raw transfer]




UDP_A_5(4EEA)
B4GT1_HUMAN
[Raw transfer]




UDP_A_6(4EEO)
B4GT1_HUMAN
[Raw transfer]




UDH_A_26(2AH9)
B4GT1_HUMAN
[Raw transfer]




UDH_C_(2AGD)
B4GT1_HUMAN
[Raw transfer]




UDH_A_5(4EE3)
B4GT1_HUMAN
[Raw transfer]




UDH_B_16(4EE3)
B4GT1_HUMAN
[Raw transfer]




UDH_B_24(2AES)
B4GT1_HUMAN
[Raw transfer]




UDP_B_12(4EEG)
B4GT1_HUMAN
[Raw transfer]




UDP_C_(4EEA)
B4GT1_HUMAN
[Raw transfer]




UDP_B_16(4EE4)
B4GT1_HUMAN
[Raw transfer]




UDP_C_(4EEA)
B4GT1_HUMAN
[Raw transfer]




UDP_A_5(4EE4)
B4GT1_HUMAN
[Raw transfer]




UDP_A_5(4EEG)
B4GT1_HUMAN
[Raw transfer]




UDP_C_(4EE4)
B4GT1_HUMAN
[Raw transfer]




UDH_C_(2AH9)
B4GT1_HUMAN
[Raw transfer]




PG4_D_18(1NKH)
B4GT1_BOVIN
[Raw transfer]




SUGAR_B_15(4EE4)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_C_26(4EE3)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_B_14(4EEA)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_B_15(4EE3)
B4GT1_HUMAN
[Raw transfer]

-

GDU_D_4(1FR8)
B4GT1_BOVIN
[Raw transfer]




SUGAR_A_4(4EE4)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_A_5(3EE5)
B4GT1_HUMAN
[Raw transfer]

-

PG4_A_13(1O23)
B4GT1_BOVIN
[Raw transfer]




SUGAR_A_4(4EE3)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_A_4(4EEA)
B4GT1_HUMAN
[Raw transfer]

-

GDU_C_3(1FR8)
B4GT1_BOVIN
[Raw transfer]




SUGAR_A_4(2AE7)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_B_5(2AE7)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_C_6(2AE7)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_B_15(3EE5)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_B_5(2AGD)
B4GT1_HUMAN
[Raw transfer]

-

UDP_A_3(2FYB)
B4GT1_HUMAN
[Raw transfer]




U5P_C_3(1FGX)
B4GT1_BOVIN
[Raw transfer]




SUGAR_C_6(2AES)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_A_4(2AGD)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_C_6(2AEC)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_C_6(2AGD)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_B_5(2AEC)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_A_4(2AES)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_B_5(2AES)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_A_4(2AEC)
B4GT1_HUMAN
[Raw transfer]

-

PG4_A_9(1NF5)
B4GT1_BOVIN
[Raw transfer]




BBV_B_13(4EEO)
B4GT1_HUMAN
[Raw transfer]




BBV_A_4(4EEO)
B4GT1_HUMAN
[Raw transfer]




PG4_A_15(1NKH)
B4GT1_BOVIN
[Raw transfer]




BBV_C_23(4EEO)
B4GT1_HUMAN
[Raw transfer]




SUGAR_A_4(4EEG)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_C_24(4EEM)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_A_4(4EEM)
B4GT1_HUMAN
[Raw transfer]

-

PG4_C_14(1O23)
B4GT1_BOVIN
[Raw transfer]




SUGAR_B_11(4EEG)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_B_13(4EEM)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_A_4(4EE5)
B4GT1_HUMAN
[Raw transfer]

-

2NA_A_6(3EE5)
B4GT1_HUMAN
[Raw transfer]




SUGAR_C_22(4EE5)
B4GT1_HUMAN
[Raw transfer]

-

2NA_B_17(3EE5)
B4GT1_HUMAN
[Raw transfer]




SUGAR_B_12(4EE5)
B4GT1_HUMAN
[Raw transfer]

-

SUGAR_C_21(4EEG)
B4GT1_HUMAN
[Raw transfer]

-

27 PsiBlast_CBE 83.9598%-113 - C1 -4EEA 5.3 B4GT1_HUMAN
33 PsiBlast_CBE 83.0998%-115 - C1 -4EE3 6.7 B4GT1_HUMAN
29 PsiBlast_CBE 82.2798%-114 - C1 -4EE5 5.4 B4GT1_HUMAN
25 PsiBlast_CBE 80.6098%-112 - C1 -4EEG 5.4 B4GT1_HUMAN
39 PsiBlast_CBE 80.0798%-111 - C1 -2AGD 7.0 B4GT1_HUMAN
31 PsiBlast_CBE 77.9698%-111 - C1 -4EE4 5.1 B4GT1_HUMAN
23 PsiBlast_CBE 77.9598%-109 - C1 -4EEM 5.5 B4GT1_HUMAN
41 PsiBlast_CBE 77.3098%-110 - C1 -2AES 6.3 B4GT1_HUMAN
40 PsiBlast_CBE 76.5598%-110 - C1 -2AGD 4.1 B4GT1_HUMAN
21 PsiBlast_CBE 76.5598%-110 - C1 -4EEO 5.5 B4GT1_HUMAN
28 PsiBlast_CBE 76.3998%-113 - C1 -4EEA 5.7 B4GT1_HUMAN
12 PsiBlast_PDB 76.1398%-111 - C1 -4EE4 5.7 B4GT1_HUMAN
34 PsiBlast_CBE 75.8798%-110 - C1 -4EE3 6.9 B4GT1_HUMAN
46 PsiBlast_CBE 75.5598%-110 - C1 -2AE7 7.4 B4GT1_HUMAN
35 PsiBlast_CBE 75.3198%-109 - C1 -3EE5 6.1 B4GT1_HUMAN
44 PsiBlast_CBE 74.8098%-111 - C1 -2AEC 7.0 B4GT1_HUMAN
14 PsiBlast_PDB 74.2898%-111 - C1 -4EEA 5.4 B4GT1_HUMAN
30 PsiBlast_CBE 73.9998%-110 - C1 -4EE5 5.6 B4GT1_HUMAN
37 PsiBlast_CBE 73.9398%-111 - C1 -2AH9 6.3 B4GT1_HUMAN
36 PsiBlast_CBE 73.9098%-111 - C1 -3EE5 7.0 B4GT1_HUMAN
26 PsiBlast_CBE 73.6998%-112 - C1 -4EEG 5.7 B4GT1_HUMAN
42 PsiBlast_CBE 73.6198%-110 - C1 -2AES 7.0 B4GT1_HUMAN
24 PsiBlast_CBE 73.6098%-111 - C1 -4EEM 5.9 B4GT1_HUMAN
22 PsiBlast_CBE 73.5198%-111 - C1 -4EEO 5.5 B4GT1_HUMAN
43 PsiBlast_CBE 73.0798%-111 - C1 -2AEC 6.6 B4GT1_HUMAN
45 PsiBlast_CBE 72.9898%-110 - C1 -2AE7 6.5 B4GT1_HUMAN
38 PsiBlast_CBE 72.9598%-109 - C1 -2AH9 3.7 B4GT1_HUMAN
16 PsiBlast_PDB 72.6298%-109 - C1 -4EEM 5.8 B4GT1_HUMAN
5 PsiBlast_PDB 71.6298%-109 - C1 -2AGD 7.0 B4GT1_HUMAN
17 PsiBlast_PDB 71.3298%-110 - C1 -4EEO 5.9 B4GT1_HUMAN
13 PsiBlast_PDB 71.1298%-109 - C1 -4EE5 5.9 B4GT1_HUMAN
11 PsiBlast_PDB 70.6198%-109 - C1 -4EE3 6.5 B4GT1_HUMAN
32 PsiBlast_CBE 70.5898%-109 - C1 -4EE4 6.0 B4GT1_HUMAN
15 PsiBlast_PDB 70.0198%-110 - C1 -4EEG 5.7 B4GT1_HUMAN
10 PsiBlast_PDB 69.6798%-109 - C1 -3EE5 6.6 B4GT1_HUMAN
9 PsiBlast_PDB 69.2998%-119 - C1 -2FYB 4.7 B4GT1_HUMAN
3 PsiBlast_PDB 68.1598%-110 - C1 -2AEC 7.0 B4GT1_HUMAN
6 PsiBlast_PDB 68.0798%-110 - C1 -2AH9 6.9 B4GT1_HUMAN
4 PsiBlast_PDB 65.7598%-110 - C1 -2AES 6.9 B4GT1_HUMAN
2 PsiBlast_PDB 65.6998%-108 - C1 -2AE7 6.9 B4GT1_HUMAN
50 PsiBlast_CBE 50.8590%-108 - C1 -1OQM 7.0 B4GT1_BOVIN
20 PsiBlast_PDB 46.9390%-109 - C1 -1NF5 3.2 B4GT1_BOVIN
60 PsiBlast_CBE 45.8290%-106 - C1 -1O0R 7.4 B4GT1_BOVIN
49 PsiBlast_CBE 45.0090%-105 * C1 *1OQM 7.8 B4GT1_BOVIN
51 PsiBlast_CBE 44.9990%-106 - C1 -1O23 6.4 B4GT1_BOVIN
56 PsiBlast_CBE 43.8090%-106 - C1 -1NQI 3.6 B4GT1_BOVIN
52 PsiBlast_CBE 43.4790%-104 - C1 -1O23 6.8 B4GT1_BOVIN
54 PsiBlast_CBE 43.0890%-106 - C1 -1NWG 3.8 B4GT1_BOVIN
57 PsiBlast_CBE 41.7790%-105 - C1 -1NKH 4.8 B4GT1_BOVIN
58 PsiBlast_CBE 40.9490%-105 - C1 -1NKH 5.4 B4GT1_BOVIN
59 PsiBlast_CBE 37.8590%-104 - C1 -1NF5 2.5 B4GT1_BOVIN
55 PsiBlast_CBE 36.8790%-102 - C1 -1NQI 3.6 B4GT1_BOVIN
53 PsiBlast_CBE 34.4790%-105 - C1 -1NWG 4.2 B4GT1_BOVIN
18 PsiBlast_PDB 23.3989%-109 - C1 -1FR8 4.1 B4GT1_BOVIN
48 PsiBlast_CBE 22.1388%-107 - C1 -1FGX 4.3 B4GT1_BOVIN
47 PsiBlast_CBE 16.9189%-108 - C1 -1FR8 3.1 B4GT1_BOVIN