@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00105_NR1I2_HUMAN: (2016-03-19 )
MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_A_3(4NY9)
NR1I2_HUMAN
[Raw transfer]




RFP_B_2(1SKX)
NR1I2_HUMAN
[Raw transfer]




SRL_A_5(1NRL)
NR1I2_HUMAN
[Raw transfer]




40U_B_6(4S0T)
NR1I2_HUMAN
[Raw transfer]




444_E_5(2O9I)
NR1I2_HUMAN
[Raw transfer]




4 PsiBlast_PDB 97.79100%-136 - C2 -4X1F - ? -
22 PsiBlast_CBE 96.0199%-131 - C2 -2O9I 7.5 NR1I2_HUMAN
5 PsiBlast_PDB 95.9899%-133 - C2 -2O9I - NR1I2_HUMAN -
21 PsiBlast_CBE 95.92100%-138 - C2 -4S0T 8.5 NR1I2_HUMAN
1 PsiBlast_PDB 95.06100%-139 - C2 -4S0T - NR1I2_HUMAN -
6 PsiBlast_PDB 93.60100%-143 - C2 -4NY9 2.1 NR1I2_HUMAN
3 PsiBlast_PDB 91.03100%-135 - C2 -3R8D - NR1I2_HUMAN -
48 Fugue 90.6999%-142 * C2 *1SKX 9.3 NR1I2_HUMAN
2 PsiBlast_PDB 90.56100%-145 - C2 -2QNV - NR1I2_HUMAN -
25 HHSearch 81.26100%-149 - C2 -1NRL 7.1 NR1I2_HUMAN
49 Fugue 74.4930%-100 - C2 -4NQA - NR1H2_HUMAN -
10 PsiBlast_PDB 73.7337%-123 - C2 -3DR1 - VDRA_DANRE -
7 PsiBlast_PDB 73.1137%-122 - C2 -2HBH - VDRA_DANRE -
18 PsiBlast_PDB 72.5737%-124 - C2 -4G1Z - VDRA_DANRE -
13 PsiBlast_PDB 72.5737%-126 - C2 -4Q0A - VDRA_DANRE -
14 PsiBlast_PDB 72.5337%-126 - C2 -4FHH - VDRA_DANRE -
8 PsiBlast_PDB 72.2537%-125 - C2 -2HC4 - VDRA_DANRE -
17 PsiBlast_PDB 72.0837%-126 - C2 -4G1Y - VDRA_DANRE -
16 PsiBlast_PDB 71.9237%-125 - C2 -4G1D - VDRA_DANRE -
11 PsiBlast_PDB 71.7037%-125 - C2 -3O1D - VDRA_DANRE -