@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00105_NR4A1_HUMAN: (2016-03-19 )
MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_B_8(3V3Q)

[Raw transfer]




GOL_B_3(4KZJ)

[Raw transfer]




GOL_A_5(4KZJ)
NR4A1_HUMAN
[Raw transfer]




GOL_B_3(4RZF)

[Raw transfer]




GOL_A_5(4RZF)
NR4A1_HUMAN
[Raw transfer]




GOL_A_5(3V3E)
NR4A1_HUMAN
[Raw transfer]




GOL_B_3(4KZM)

[Raw transfer]




GOL_A_5(4KZI)
NR4A1_HUMAN
[Raw transfer]




GOL_B_3(4RZG)

[Raw transfer]




GOL_A_5(4REE)
?
[Raw transfer]




GOL_B_3(4REF)
?
[Raw transfer]




GOL_B_3(4RZE)

[Raw transfer]




GOL_B_3(3V3E)

[Raw transfer]




GOL_A_5(4RZG)
NR4A1_HUMAN
[Raw transfer]




GOL_A_4(4REF)
?
[Raw transfer]




GOL_B_3(4KZI)

[Raw transfer]




GOL_B_3(4WHG)
?
[Raw transfer]




GOL_A_4(4WHG)
?
[Raw transfer]




GOL_A_4(4RE8)
?
[Raw transfer]




GOL_A_5(4KZM)
NR4A1_HUMAN
[Raw transfer]




GOL_B_3(4REE)
?
[Raw transfer]




GOL_A_5(4RZE)
NR4A1_HUMAN
[Raw transfer]




GOL_B_10(4JGV)

[Raw transfer]




GOL_B_3(4WHF)
?
[Raw transfer]




GOL_A_4(4WHF)
?
[Raw transfer]




25 PsiBlast_CBE 92.08100%-147 - C5 -3V3Q 2.0
5 PsiBlast_PDB 91.91100%-147 - C5 -4WHG 2.4 ?
7 PsiBlast_PDB 91.90100%-148 - C5 -4REE 2.3 ?
6 PsiBlast_PDB 91.45100%-146 - C5 -4RZG 2.3
22 PsiBlast_CBE 91.41100%-147 - C5 -4WHG 2.3 ?
3 PsiBlast_PDB 91.08100%-147 - C5 -4KZI 2.5
28 PsiBlast_CBE 90.48100%-145 - C5 -4REE 2.1 ?
11 PsiBlast_PDB 90.3299%-147 - C5 -4RZF 2.5
10 PsiBlast_PDB 90.2899%-145 - C5 -4REF 1.9 ?
2 PsiBlast_PDB 90.21100%-145 - C5 -3V3E 2.5
26 PsiBlast_CBE 90.18100%-148 - C5 -3V3E 2.4 NR4A1_HUMAN
9 PsiBlast_PDB 90.0899%-151 - C5 -4KZJ 2.7
24 PsiBlast_CBE 89.96100%-148 - C5 -4KZI 2.2 NR4A1_HUMAN
4 PsiBlast_PDB 89.90100%-145 - C5 -4WHF 2.2 ?
12 PsiBlast_PDB 89.8699%-148 - C5 -4RZE 2.3
8 PsiBlast_PDB 89.8199%-147 - C5 -4KZM 2.5
33 PsiBlast_CBE 89.7699%-145 - C5 -4RZF 2.3 NR4A1_HUMAN
29 PsiBlast_CBE 89.52100%-145 - C5 -4RE8 1.8 ?
27 PsiBlast_CBE 89.46100%-146 - C5 -4RZG 2.1 NR4A1_HUMAN
23 PsiBlast_CBE 89.30100%-147 - C5 -4WHF 3.4 ?
34 PsiBlast_CBE 88.8399%-145 - C5 -4RZE 3.3 NR4A1_HUMAN
30 PsiBlast_CBE 88.7299%-144 - C5 -4KZM 1.8 NR4A1_HUMAN
31 PsiBlast_CBE 88.6599%-143 - C5 -4KZJ 2.7 NR4A1_HUMAN
32 PsiBlast_CBE 88.2499%-143 - C5 -4REF 1.9 ?
21 PsiBlast_CBE 87.94100%-150 - C5 -4JGV 2.3