@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00105_PPARD_HUMAN: (2016-03-19 )
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY

Atome Classification :

(37 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IL2_B_4(3SP9)
PPARD_HUMAN
[Raw transfer]




IL2_A_3(3SP9)
PPARD_HUMAN
[Raw transfer]




3EQ_B_10(3PEQ)
PPARD_HUMAN
[Raw transfer]




VCA_A_7(2B50)
PPARD_HUMAN
[Raw transfer]




3EQ_A_3(3PEQ)
PPARD_HUMAN
[Raw transfer]




L41_B_4(3D5F)
PPARD_HUMAN
[Raw transfer]




VCA_B_8(2B50)
PPARD_HUMAN
[Raw transfer]




L41_A_3(3D5F)
PPARD_HUMAN
[Raw transfer]




VCA_E_5(2AWH)
PPARD_HUMAN
[Raw transfer]




VCA_F_6(2AWH)
PPARD_HUMAN
[Raw transfer]




VCA_F_6(2BAW)
PPARD_HUMAN
[Raw transfer]




K55_A_4(2ZNP)
PPARD_HUMAN
[Raw transfer]




GW0_A_2(3TKM)
PPARD_HUMAN
[Raw transfer]




331_N_14(1Y0S)
PPARD_HUMAN
[Raw transfer]




401_B_6(2ZNQ)
PPARD_HUMAN
[Raw transfer]




331_O_15(1Y0S)
PPARD_HUMAN
[Raw transfer]




401_A_4(2ZNQ)
PPARD_HUMAN
[Raw transfer]




13M_A_2(3VI8)
PPARA_HUMAN
[Raw transfer]




K55_B_6(2ZNP)
PPARD_HUMAN
[Raw transfer]




3OZ_A_2(3OZ0)
PPARD_HUMAN
[Raw transfer]




ET1_B_7(3ET2)
PPARD_HUMAN
[Raw transfer]




WLM_A_3(2XYJ)
PPARD_HUMAN
[Raw transfer]




WLM_B_6(2XYJ)
PPARD_HUMAN
[Raw transfer]




DY6_A_4(3DY6)
PPARD_HUMAN
[Raw transfer]




DY6_B_5(3DY6)
PPARD_HUMAN
[Raw transfer]




ET1_A_3(3ET2)
PPARD_HUMAN
[Raw transfer]




08S_A_3(2XYW)
PPARD_HUMAN
[Raw transfer]




Z00_A_3(2XYX)
PPARD_HUMAN
[Raw transfer]




1FA_A_3(2Q5G)
PPARD_HUMAN
[Raw transfer]




Z00_B_5(2XYX)
PPARD_HUMAN
[Raw transfer]




08S_B_5(2XYW)
PPARD_HUMAN
[Raw transfer]




1FA_B_4(2Q5G)
PPARD_HUMAN
[Raw transfer]




EPA_B_4(3GWX)
PPARD_HUMAN
[Raw transfer]




15 PsiBlast_PDB 97.36100%-145 - C3 -3TKM 9.0 PPARD_HUMAN
17 PsiBlast_PDB 96.82100%-144 - C3 -3SP9 8.5 PPARD_HUMAN
34 PsiBlast_CBE 96.7499%-143 - C3 -2B50 7.7 PPARD_HUMAN
9 PsiBlast_PDB 96.63100%-141 - C3 -2ZNQ 8.7 PPARD_HUMAN
12 PsiBlast_PDB 96.21100%-147 - C- -3GWX - PPARD_HUMAN -
16 PsiBlast_PDB 96.1899%-142 - C3 -2B50 7.3 PPARD_HUMAN
35 PsiBlast_CBE 95.93100%-142 - C3 -3SP9 8.1 PPARD_HUMAN
20 PsiBlast_PDB 95.9099%-139 - C- -2GWX - PPARD_HUMAN -
5 PsiBlast_PDB 95.81100%-136 - C3 -2XYJ 8.4 PPARD_HUMAN
4 PsiBlast_PDB 95.8099%-142 - C3 -3ET2 7.4 PPARD_HUMAN
32 PsiBlast_CBE 95.78100%-149 - C3 -3DY6 8.5 PPARD_HUMAN
13 PsiBlast_PDB 95.63100%-150 - C3 -3DY6 8.1 PPARD_HUMAN
28 PsiBlast_CBE 95.59100%-140 - C3 -2ZNP 9.9 PPARD_HUMAN
27 PsiBlast_CBE 95.47100%-141 - C3 -2ZNQ 8.8 PPARD_HUMAN
23 PsiBlast_CBE 95.3999%-142 - C3 -3ET2 6.8 PPARD_HUMAN
11 PsiBlast_PDB 95.39100%-146 - C- -1GWX - PPARD_HUMAN -
24 PsiBlast_CBE 95.33100%-137 - C3 -2XYX 8.8 PPARD_HUMAN
18 PsiBlast_PDB 95.2499%-140 - C3 -3GZ9 - PPARD_HUMAN -
10 PsiBlast_PDB 95.22100%-142 - C3 -1Y0S 8.6 PPARD_HUMAN
31 PsiBlast_CBE 94.99100%-134 - C3 -3GWX 5.6 PPARD_HUMAN
38 PsiBlast_CBE 94.7999%-143 - C3 -3D5F 9.2 PPARD_HUMAN
14 PsiBlast_PDB 94.73100%-146 - C3 -3PEQ 10.4 PPARD_HUMAN
26 PsiBlast_CBE 94.72100%-141 - C3 -2XYJ 8.4 PPARD_HUMAN
30 PsiBlast_CBE 94.68100%-147 - C3 -3PEQ 10.6 PPARD_HUMAN
37 PsiBlast_CBE 94.6799%-144 - C3 -3D5F 8.8 PPARD_HUMAN
6 PsiBlast_PDB 94.67100%-144 - C3 -2XYW 9.6 PPARD_HUMAN
36 PsiBlast_CBE 94.4599%-148 - C3 -2AWH 6.7 PPARD_HUMAN
8 PsiBlast_PDB 94.44100%-142 - C3 -2ZNP 9.3 PPARD_HUMAN
7 PsiBlast_PDB 94.41100%-143 - C3 -2XYX 8.7 PPARD_HUMAN
3 PsiBlast_PDB 94.0099%-144 - C3 -3OZ0 10.3 PPARD_HUMAN
25 PsiBlast_CBE 93.71100%-143 - C3 -2XYW 9.8 PPARD_HUMAN
39 PsiBlast_CBE 93.6799%-147 - C3 -2BAW 6.6 PPARD_HUMAN
29 PsiBlast_CBE 93.61100%-142 - C3 -1Y0S 9.0 PPARD_HUMAN
19 PsiBlast_PDB 93.2799%-144 - C3 -2AWH 7.1 PPARD_HUMAN
42 HHSearch 88.0670%-134 * C3 *3VI8 8.1 PPARA_HUMAN
21 PsiBlast_CBE 87.8899%-148 - C3 -2Q5G 11.4 PPARD_HUMAN
1 PsiBlast_PDB 87.3399%-134 - C3 -2Q5G 11.2 PPARD_HUMAN