@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00105_PPARG_MOUSE: (2016-03-19 )
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY

Atome Classification :

(166 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2PQ_A_3(3GBK)
PPARG_HUMAN
[Raw transfer]




UNT_A_3(3IA6)
PPARG_HUMAN
[Raw transfer]




072_A_5(4PRG)
PPARG_HUMAN
[Raw transfer]




AZ2_C_3(1I7I)
PPARG_HUMAN
[Raw transfer]




5BC_B_4(3NOA)
PPARG_HUMAN
[Raw transfer]




4HD_A_3(2VV1)
PPARG_HUMAN
[Raw transfer]




RO7_A_3(3G9E)
PPARG_HUMAN
[Raw transfer]




5BC_A_3(3NOA)
PPARG_HUMAN
[Raw transfer]




M7S_A_3(3AN3)
PPARG_HUMAN
[Raw transfer]




AZ2_D_4(1I7I)
PPARG_HUMAN
[Raw transfer]




208_A_3(2GTK)
PPARG_HUMAN
[Raw transfer]




DRD_A_3(2HWR)
PPARG_HUMAN
[Raw transfer]




UNT_B_4(3IA6)
PPARG_HUMAN
[Raw transfer]




ZAA_A_2(3BC5)
PPARG_HUMAN
[Raw transfer]




EK8_A_3(3VSP)
PPARG_HUMAN
[Raw transfer]




L92_A_3(2Q8S)
PPARG_HUMAN
[Raw transfer]




3JX_D_4(4R2U)
PPARG_HUMAN
[Raw transfer]




CTM_A_3(3FEJ)
PPARG_HUMAN
[Raw transfer]




24L_A_3(3V9Y)
PPARG_HUMAN
[Raw transfer]




GW4_A_3(2POB)
PPARG_HUMAN
[Raw transfer]




EK1_A_3(3VSO)
PPARG_HUMAN
[Raw transfer]




ET1_A_3(3ET3)
PPARG_HUMAN
[Raw transfer]




5HE_A_3(2VV2)
PPARG_HUMAN
[Raw transfer]




3JX_A_3(4R2U)
PPARG_HUMAN
[Raw transfer]




DRY_A_3(2HWQ)
PPARG_HUMAN
[Raw transfer]




072_C_7(4PRG)
PPARG_HUMAN
[Raw transfer]




072_D_8(4PRG)
PPARG_HUMAN
[Raw transfer]




538_D_6(3KMG)
PPARG_HUMAN
[Raw transfer]




DRJ_C_3(2I4J)
PPARG_HUMAN
[Raw transfer]




HIG_A_3(3R8A)
PPARG_HUMAN
[Raw transfer]




S44_B_4(2ZNO)
PPARG_HUMAN
[Raw transfer]




13M_A_2(3VI8)
PPARA_HUMAN
[Raw transfer]




3K2_B_4(4R6S)
PPARG_HUMAN
[Raw transfer]




GOL_B_4(2POB)
PPARG_HUMAN
[Raw transfer]




5OX_A_3(3X1H)
PPARG_HUMAN
[Raw transfer]




538_A_5(3KMG)
PPARG_HUMAN
[Raw transfer]




EHA_C_3(2F4B)
PPARG_HUMAN
[Raw transfer]




M7R_A_3(3AN4)
PPARG_HUMAN
[Raw transfer]




OCR_A_3(2ZK4)
PPARG_HUMAN
[Raw transfer]




Y1N_A_3(4CI5)
PPARG_HUMAN
[Raw transfer]




TLS_A_3(3VN2)
PPARG_HUMAN
[Raw transfer]




PTG_A_3(2ZVT)
PPARG_HUMAN
[Raw transfer]




XCX_A_3(3R8I)
PPARG_HUMAN
[Raw transfer]




YFE_B_4(2YFE)
PPARG_HUMAN
[Raw transfer]




072_B_6(4PRG)
PPARG_HUMAN
[Raw transfer]




S44_A_3(2ZNO)
PPARG_HUMAN
[Raw transfer]




JJA_B_4(3WMH)
PPARG_HUMAN
[Raw transfer]




3EA_C_3(2ATH)
PPARG_HUMAN
[Raw transfer]




DRH_A_3(2I4Z)
PPARG_HUMAN
[Raw transfer]




0W3_A_3(4FGY)
PPARG_HUMAN
[Raw transfer]




JJA_A_3(3WMH)
PPARG_HUMAN
[Raw transfer]




M0T_A_3(3S9S)
PPARG_HUMAN
[Raw transfer]




21L_A_3(3V9V)
PPARG_HUMAN
[Raw transfer]




486_A_3(3QT0)
PPARG_HUMAN
[Raw transfer]




3K2_A_3(4R6S)
PPARG_HUMAN
[Raw transfer]




C01_C_3(1ZEO)
PPARG_HUMAN
[Raw transfer]




LRG_A_3(3B3K)
PPARG_HUMAN
[Raw transfer]




4R8_A_3(2VV3)
PPARG_HUMAN
[Raw transfer]




F22_A_3(2VV0)
PPARG_HUMAN
[Raw transfer]




14R_X_3(4HEE)
PPARG_HUMAN
[Raw transfer]




240_B_4(2Q59)
PPARG_HUMAN
[Raw transfer]




D30_D_6(3H0A)
PPARG_HUMAN
[Raw transfer]




GRR_A_3(3CDS)
PPARG_HUMAN
[Raw transfer]




YFE_A_3(2YFE)
PPARG_HUMAN
[Raw transfer]




LNA_A_5(3CWD)
PPARG_HUMAN
[Raw transfer]




LNA_B_7(3CWD)
PPARG_HUMAN
[Raw transfer]




DRH_C_3(2I4P)
PPARG_HUMAN
[Raw transfer]




DKD_A_3(3HO0)
PPARG_HUMAN
[Raw transfer]




5OX_B_4(3X1H)
PPARG_HUMAN
[Raw transfer]




LRG_B_4(4L98)
PPARG_HUMAN
[Raw transfer]




3EA_D_4(2ATH)
PPARG_HUMAN
[Raw transfer]




ZXG_A_3(3PBA)
PPARG_HUMAN
[Raw transfer]




4HD_B_4(2VV1)
PPARG_HUMAN
[Raw transfer]




ZZH_A_3(3HOD)
PPARG_HUMAN
[Raw transfer]




AJA_B_7(2OM9)
PPARG_HUMAN
[Raw transfer]




240_A_3(2Q59)
PPARG_HUMAN
[Raw transfer]




241_A_3(2Q5P)
PPARG_HUMAN
[Raw transfer]




243_A_3(2VST)
PPARG_HUMAN
[Raw transfer]




HIG_B_4(3R8A)
PPARG_HUMAN
[Raw transfer]




LRG_A_2(4L96)
PPARG_HUMAN
[Raw transfer]




Y1N_B_4(4CI5)
PPARG_HUMAN
[Raw transfer]




CEK_A_3(3LMP)
PPARG_HUMAN
[Raw transfer]




C08_B_4(2ZK6)
PPARG_HUMAN
[Raw transfer]




NRO_A_3(2ZK5)
PPARG_HUMAN
[Raw transfer]




LRG_A_3(3D6D)
PPARG_HUMAN
[Raw transfer]




J35_A_3(3VJH)
PPARG_HUMAN
[Raw transfer]




AJA_D_12(2OM9)
PPARG_HUMAN
[Raw transfer]




MYI_A_4(3ADU)
PPARG_HUMAN
[Raw transfer]




OCX_A_3(2ZK3)
PPARG_HUMAN
[Raw transfer]




243_B_4(2VST)
PPARG_HUMAN
[Raw transfer]




YFD_B_4(4A4V)
PPARG_HUMAN
[Raw transfer]




6OB_B_4(2VV4)
PPARG_HUMAN
[Raw transfer]




AJA_C_9(2OM9)
PPARG_HUMAN
[Raw transfer]




AJA_A_5(2OM9)
PPARG_HUMAN
[Raw transfer]




ET0_A_3(3ET0)
PPARG_HUMAN
[Raw transfer]




LRG_A_3(4L98)
PPARG_HUMAN
[Raw transfer]




SF1_A_4(2Q61)
PPARG_HUMAN
[Raw transfer]




NRO_B_4(2ZK5)
PPARG_HUMAN
[Raw transfer]




RRG_A_4(4E4K)
PPARG_HUMAN
[Raw transfer]




17L_A_3(3V9T)
PPARG_HUMAN
[Raw transfer]




MLO_A_3(3R5N)
PPARG_HUMAN
[Raw transfer]




RO0_C_3(2FVJ)
PPARG_HUMAN
[Raw transfer]




RRH_A_3(4E4Q)
PPARG_HUMAN
[Raw transfer]




T9T_B_4(3WJ5)
PPARG_HUMAN
[Raw transfer]




YFD_A_3(4A4V)
PPARG_HUMAN
[Raw transfer]




IMN_A_4(3ADX)
PPARG_HUMAN
[Raw transfer]




NSI_D_4(2HFP)
PPARG_HUMAN
[Raw transfer]




GW9_B_4(3B0R)
PPARG_HUMAN
[Raw transfer]




SF2_A_3(2Q6R)
PPARG_HUMAN
[Raw transfer]




9HO_B_5(2VSR)
PPARG_HUMAN
[Raw transfer]




YFB_B_4(4A4W)
PPARG_HUMAN
[Raw transfer]




AXY_A_3(4JL4)
PPARG_HUMAN
[Raw transfer]




SF1_B_3(2Q61)
PPARG_HUMAN
[Raw transfer]




YRG_A_3(3CDP)
PPARG_HUMAN
[Raw transfer]




IMN_A_4(3ADS)
PPARG_HUMAN
[Raw transfer]




DKA_A_3(3U9Q)
PPARG_HUMAN
[Raw transfer]




C08_A_3(2ZK6)
PPARG_HUMAN
[Raw transfer]




T9T_A_3(3WJ5)
PPARG_HUMAN
[Raw transfer]




FCM_A_3(4F9M)
PPARG_HUMAN
[Raw transfer]




66B_A_3(3X1I)
PPARG_HUMAN
[Raw transfer]




XPT_B_4(3PO9)
PPARG_HUMAN
[Raw transfer]




DKA_A_3(3U9Q)
PPARG_HUMAN
[Raw transfer]




PTG_B_4(2ZVT)
PPARG_HUMAN
[Raw transfer]




TBY_A_3(3WJ4)
PPARG_HUMAN
[Raw transfer]




6OC_A_3(2VV4)
PPARG_HUMAN
[Raw transfer]




TBY_B_4(3WJ4)
PPARG_HUMAN
[Raw transfer]




NZA_B_3(2Q5S)
PPARG_HUMAN
[Raw transfer]




Z12_A_3(3FUR)
PPARG_HUMAN
[Raw transfer]




KRC_A_3(3B1M)
PPARG_HUMAN
[Raw transfer]




Z27_A_3(3K8S)
PPARG_HUMAN
[Raw transfer]




66B_B_4(3X1I)
PPARG_HUMAN
[Raw transfer]




IMN_B_5(3ADX)
PPARG_HUMAN
[Raw transfer]




SP0_C_3(2G0G)
PPARG_HUMAN
[Raw transfer]




NZA_A_4(2Q5S)
PPARG_HUMAN
[Raw transfer]




SF2_B_4(2Q6R)
PPARG_HUMAN
[Raw transfer]




CTI_A_3(4Y29)
?
[Raw transfer]




PTG_A_3(2ZK1)
PPARG_HUMAN
[Raw transfer]




F22_B_4(2VV0)
PPARG_HUMAN
[Raw transfer]




OCR_B_4(2ZK4)
PPARG_HUMAN
[Raw transfer]




XPT_A_3(3PO9)
PPARG_HUMAN
[Raw transfer]




XDI_A_3(3OSW)
PPARG_HUMAN
[Raw transfer]




DIF_A_2(4OJ4)
PPARG_HUMAN
[Raw transfer]




IMN_B_5(3ADS)
PPARG_HUMAN
[Raw transfer]




Z27_B_5(3K8S)
PPARG_HUMAN
[Raw transfer]




PTG_B_4(2ZK1)
PPARG_HUMAN
[Raw transfer]




OCR_A_4(3ADW)
PPARG_HUMAN
[Raw transfer]




PLB_D_12(3DZU)
PPARG_HUMAN
[Raw transfer]




OCX_B_4(2ZK3)
PPARG_HUMAN
[Raw transfer]




PLB_B_3(2Q6S)
PPARG_HUMAN
[Raw transfer]




PTG_A_4(2ZK2)
PPARG_HUMAN
[Raw transfer]




STL_A_3(4JAZ)
PPARG_HUMAN
[Raw transfer]




GW9_D_12(3E00)
PPARG_HUMAN
[Raw transfer]




SP3_D_4(2G0H)
PPARG_HUMAN
[Raw transfer]




SP3_C_3(2G0H)
PPARG_HUMAN
[Raw transfer]




XDH_A_3(3OSI)
PPARG_HUMAN
[Raw transfer]




OCR_B_5(3ADW)
PPARG_HUMAN
[Raw transfer]




MYI_B_7(3ADU)
PPARG_HUMAN
[Raw transfer]




5HE_B_5(2VV2)
PPARG_HUMAN
[Raw transfer]




LU2_B_5(3SZ1)
PPARG_HUMAN
[Raw transfer]




HID_A_4(3ADT)
PPARG_HUMAN
[Raw transfer]




MSZ_A_3(4PWL)
PPARG_HUMAN
[Raw transfer]




9HO_A_4(2VSR)
PPARG_HUMAN
[Raw transfer]




GLC_B_4(3ET0)
PPARG_HUMAN
[Raw transfer]




KNA_A_4(3SZ1)
PPARG_HUMAN
[Raw transfer]




SRO_A_4(3ADV)
PPARG_HUMAN
[Raw transfer]




SRO_B_5(3ADV)
PPARG_HUMAN
[Raw transfer]




2 PsiBlast_PDB 93.5398%-130 - C3 -3E00 4.2 PPARG_HUMAN
1 PsiBlast_PDB 91.2398%-128 - C3 -3DZU 6.7 PPARG_HUMAN
165 PsiBlast_CBE 83.9798%-134 - C3 -3ET3 7.6 PPARG_HUMAN
160 PsiBlast_CBE 83.7898%-136 - C3 -2FVJ 11.3 PPARG_HUMAN
66 PsiBlast_CBE 83.7898%-137 - C3 -3OSW 7.8 PPARG_HUMAN
11 PsiBlast_PDB 83.6797%-133 - C3 -4A4V 6.7 PPARG_HUMAN
151 PsiBlast_CBE 83.4098%-136 - C3 -3FEJ 8.6 PPARG_HUMAN
150 PsiBlast_CBE 83.4098%-136 - C3 -3G9E 8.7 PPARG_HUMAN
134 PsiBlast_CBE 83.3797%-135 - C3 -3V9V 10.2 PPARG_HUMAN
109 PsiBlast_CBE 83.3698%-135 - C3 -2Q5S 8.7 PPARG_HUMAN
155 PsiBlast_CBE 83.3498%-132 - C3 -2HWQ 8.9 PPARG_HUMAN
63 PsiBlast_CBE 83.3198%-135 - C3 -3VN2 10.2 PPARG_HUMAN
156 PsiBlast_CBE 83.2898%-134 - C3 -2GTK 9.1 PPARG_HUMAN
184 PsiBlast_CBE 83.0597%-135 * C3 *3ET0 5.2 PPARG_HUMAN
99 PsiBlast_CBE 83.0398%-137 - C3 -2OM9 7.4 PPARG_HUMAN
60 PsiBlast_CBE 82.9898%-132 - C3 -3PBA 7.7 PPARG_HUMAN
10 PsiBlast_PDB 82.8397%-131 - C3 -2YFE 7.2 PPARG_HUMAN
75 PsiBlast_CBE 82.8198%-134 - C3 -3R5N 7.0 PPARG_HUMAN
154 PsiBlast_CBE 82.7998%-134 - C3 -2HWR 11.2 PPARG_HUMAN
33 PsiBlast_CBE 82.7297%-130 - C3 -3VSO 9.3 PPARG_HUMAN
107 PsiBlast_CBE 82.6398%-134 - C3 -2Q61 8.0 PPARG_HUMAN
97 PsiBlast_CBE 82.6298%-136 - C3 -2OM9 7.6 PPARG_HUMAN
167 PsiBlast_CBE 82.5998%-140 - C3 -4HEE 11.7 PPARG_HUMAN
146 PsiBlast_CBE 82.5298%-126 - C3 -3NOA 11.9 PPARG_HUMAN
58 PsiBlast_CBE 82.5398%-133 - C3 -3PO9 4.6 PPARG_HUMAN
7 PsiBlast_PDB 82.5297%-127 - C3 -3ADW 5.0 PPARG_HUMAN
161 PsiBlast_CBE 82.4698%-126 - C3 -2F4B 10.9 PPARG_HUMAN
91 PsiBlast_CBE 82.4698%-134 - C3 -2VST 6.1 PPARG_HUMAN
100 PsiBlast_CBE 82.4598%-125 - C3 -2OM9 8.2 PPARG_HUMAN
98 PsiBlast_CBE 82.4198%-126 - C3 -2OM9 8.0 PPARG_HUMAN
122 PsiBlast_CBE 82.3898%-135 - C3 -3FUR 10.7 PPARG_HUMAN
136 PsiBlast_CBE 82.3697%-126 - C3 -3LMP 9.1 PPARG_HUMAN
67 PsiBlast_CBE 82.3498%-131 - C3 -3OSI 7.7 PPARG_HUMAN
133 PsiBlast_CBE 82.2597%-131 - C3 -3V9Y 11.4 PPARG_HUMAN
93 PsiBlast_CBE 82.2398%-133 - C3 -2VSR 3.8 PPARG_HUMAN
163 PsiBlast_CBE 82.2098%-124 - C3 -2ATH 9.7 PPARG_HUMAN
34 PsiBlast_CBE 82.2197%-133 - C3 -3VJH 7.1 PPARG_HUMAN
83 PsiBlast_CBE 82.2098%-137 - C3 -2VV4 4.0 PPARG_HUMAN
132 PsiBlast_CBE 82.1997%-131 - C3 -4F9M 9.6 PPARG_HUMAN
171 PsiBlast_CBE 82.1798%-130 - C3 -3CWD 3.9 PPARG_HUMAN
46 PsiBlast_CBE 82.1597%-128 - C3 -2ZK6 7.5 PPARG_HUMAN
116 PsiBlast_CBE 82.1498%-132 - C3 -4CI5 9.1 PPARG_HUMAN
137 PsiBlast_CBE 82.1397%-131 - C3 -3B1M 9.3 PPARG_HUMAN
32 PsiBlast_CBE 82.1097%-128 - C3 -3VSP 10.8 PPARG_HUMAN
182 PsiBlast_CBE 82.0998%-132 - C3 -3U9Q 4.9 PPARG_HUMAN
19 PsiBlast_PDB 82.0797%-131 - C3 -2I4J 7.5 PPARG_HUMAN
53 PsiBlast_CBE 82.0597%-126 - C3 -2ZK2 4.6 PPARG_HUMAN
102 PsiBlast_CBE 82.0497%-133 - C3 -4R6S 6.6 PPARG_HUMAN
181 PsiBlast_CBE 82.0098%-129 - C3 -4Y29 6.0 ?
158 PsiBlast_CBE 82.0098%-124 - C3 -2G0H 9.8 PPARG_HUMAN
96 PsiBlast_CBE 81.9398%-132 - C3 -3SZ1 3.7 PPARG_HUMAN
72 PsiBlast_CBE 81.9398%-128 - C3 -1ZEO 9.5 PPARG_HUMAN
159 PsiBlast_CBE 81.9098%-128 - C3 -2G0G 9.3 PPARG_HUMAN
39 PsiBlast_CBE 81.8797%-129 - C3 -3CDP 5.3 PPARG_HUMAN
6 PsiBlast_PDB 81.8597%-132 - C3 -3ADV 3.9 PPARG_HUMAN
180 PsiBlast_CBE 81.8397%-134 - C3 -2Q59 9.9 PPARG_HUMAN
148 PsiBlast_CBE 81.8298%-132 - C3 -3IA6 9.9 PPARG_HUMAN
62 PsiBlast_CBE 81.8198%-135 - C3 -1I7I 8.1 PPARG_HUMAN
129 PsiBlast_CBE 81.7998%-123 - C3 -2HFP 10.4 PPARG_HUMAN
65 PsiBlast_CBE 81.7697%-128 - C3 -2ZVT 6.0 PPARG_HUMAN
3 PsiBlast_PDB 81.7697%-132 - C3 -3ADS 7.5 PPARG_HUMAN
87 PsiBlast_CBE 81.7298%-132 - C3 -2VV1 6.6 PPARG_HUMAN
20 PsiBlast_PDB 81.6697%-126 - C3 -2I4P 7.5 PPARG_HUMAN
117 PsiBlast_CBE 81.6598%-133 - C3 -3KMG 12.7 PPARG_HUMAN
74 PsiBlast_CBE 81.6598%-131 - C3 -3BC5 11.5 PPARG_HUMAN
48 PsiBlast_CBE 81.6397%-126 - C3 -2ZK5 5.1 PPARG_HUMAN
8 PsiBlast_PDB 81.6197%-127 - C3 -3ADX 7.9 PPARG_HUMAN