@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00105_PRGR_PONPY: (2016-03-19 )
IQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK

Atome Classification :

(34 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

A2K_B_5(4APU)

[Raw transfer]




AS0_B_5(4A2J)

[Raw transfer]




AS0_A_3(4A2J)
PRGR_HUMAN
[Raw transfer]




STR_A_3(1A28)
PRGR_HUMAN
[Raw transfer]




STR_A_3(1A28)
PRGR_HUMAN
[Raw transfer]




R18_A_3(1E3K)
PRGR_HUMAN
[Raw transfer]




2S0_A_3(4OAR)

[Raw transfer]




T98_E_5(1ZUC)

[Raw transfer]




R18_B_4(1E3K)

[Raw transfer]




NOG_A_3(3D90)
PRGR_HUMAN
[Raw transfer]




NOG_B_4(3D90)

[Raw transfer]




AS0_C_3(2OVM)

[Raw transfer]




NDR_C_3(1SQN)
PRGR_HUMAN
[Raw transfer]




STR_B_4(1A28)

[Raw transfer]




T98_D_4(1ZUC)
PRGR_HUMAN
[Raw transfer]




AS0_A_3(2OVH)

[Raw transfer]




NDR_D_4(1SQN)

[Raw transfer]




OR8_A_3(4APU)
PRGR_HUMAN
[Raw transfer]




NDR_C_3(1SQN)
PRGR_HUMAN
[Raw transfer]




MOF_A_4(1SR7)
PRGR_HUMAN
[Raw transfer]




DEX_A_4(3MNP)

[Raw transfer]




GKK_B_9(3HQ5)

[Raw transfer]




OR8_B_10(3ZR7)

[Raw transfer]




WOW_B_5(3KBA)

[Raw transfer]




GKK_A_7(3HQ5)
PRGR_HUMAN
[Raw transfer]




ORC_B_8(3ZRB)

[Raw transfer]




STR_A_3(4FN9)
?
[Raw transfer]




30X_B_4(3G8O)

[Raw transfer]




ORB_A_3(3ZRA)
PRGR_HUMAN
[Raw transfer]




30X_A_3(3G8O)
PRGR_HUMAN
[Raw transfer]




MOF_B_5(1SR7)

[Raw transfer]




OR8_A_3(3ZR7)
PRGR_HUMAN
[Raw transfer]




OR8_A_3(3ZRB)
PRGR_HUMAN
[Raw transfer]




ORB_B_5(3ZRA)

[Raw transfer]




61 Fugue 97.2198%-148 - C3 -1A28 7.6 PRGR_HUMAN
1 PsiBlast_PDB 96.50100%-138 - C3 -1A28 7.9 PRGR_HUMAN
7 PsiBlast_PDB 95.94100%-139 - C3 -1E3K 7.1 PRGR_HUMAN
28 PsiBlast_CBE 95.46100%-138 - C3 -4A2J 8.9
29 PsiBlast_CBE 95.38100%-140 - C3 -3ZRB 6.2
36 HHSearch 95.31100%-139 - C3 -1SQN 7.5 PRGR_HUMAN
9 PsiBlast_PDB 95.31100%-139 - C3 -1SQN 7.5 PRGR_HUMAN
15 PsiBlast_PDB 95.29100%-136 - C3 -4APU 6.2 PRGR_HUMAN
35 PsiBlast_CBE 95.24100%-141 - C3 -3G8O 6.8
24 PsiBlast_CBE 95.18100%-138 - C3 -3D90 8.1
17 PsiBlast_PDB 94.99100%-140 - C3 -1ZUC 8.0
21 PsiBlast_CBE 94.91100%-141 - C3 -3HQ5 9.5
14 PsiBlast_PDB 94.83100%-140 - C3 -4A2J 9.5 PRGR_HUMAN
16 PsiBlast_PDB 94.80100%-139 - C3 -1SR7 10.6 PRGR_HUMAN
33 PsiBlast_CBE 94.74100%-136 - C3 -1ZUC 7.7 PRGR_HUMAN
13 PsiBlast_PDB 94.70100%-134 - C3 -3ZRB 7.2 PRGR_HUMAN
34 PsiBlast_CBE 94.65100%-139 - C3 -1SR7 10.0
23 PsiBlast_CBE 94.62100%-141 - C3 -3KBA 7.7
11 PsiBlast_PDB 94.51100%-139 - C3 -3ZR7 7.2 PRGR_HUMAN
4 PsiBlast_PDB 94.41100%-144 - C3 -3HQ5 9.6 PRGR_HUMAN
31 PsiBlast_CBE 94.40100%-138 - C3 -3ZR7 7.3
30 PsiBlast_CBE 94.27100%-133 - C3 -3ZRA 6.9
18 PsiBlast_PDB 94.26100%-137 - C3 -3G8O 6.8 PRGR_HUMAN
22 PsiBlast_CBE 94.19100%-137 - C3 -1A28 8.1
26 PsiBlast_CBE 94.16100%-139 - C3 -1SQN 7.6
27 PsiBlast_CBE 93.76100%-138 - C3 -4APU 12.0
12 PsiBlast_PDB 93.64100%-139 - C3 -3ZRA 7.0 PRGR_HUMAN
25 PsiBlast_CBE 93.57100%-139 - C3 -1E3K 7.3
8 PsiBlast_PDB 92.95100%-134 - C3 -3D90 7.7 PRGR_HUMAN
2 PsiBlast_PDB 90.50100%-136 - C3 -2OVH 8.7
3 PsiBlast_PDB 89.97100%-138 - C3 -2OVM 8.1
6 PsiBlast_PDB 87.48100%-133 - C3 -4OAR 9.1
20 PsiBlast_PDB 81.7867%-129 - C3 -4FN9 7.3 ?
37 HHSearch 81.0256%-138 - C3 -3MNP 6.6