@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00105_RARA_MOUSE: (2016-03-19 )
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTSLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFDVGMSKESVRNDRNKKKKEAPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP

Atome Classification :

(32 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

1NY_A_5(4JYG)
RARB_HUMAN
[Raw transfer]




1NY_B_7(4JYG)
RARB_HUMAN
[Raw transfer]




JYH_B_6(4JYH)
RARB_HUMAN
[Raw transfer]




BMS_C_3(1DKF)
RARA_HUMAN
[Raw transfer]




REA_B_5(3A9E)
RARA_HUMAN
[Raw transfer]




TTB_A_5(4DM6)
RARB_HUMAN
[Raw transfer]




184_A_2(1FCX)
RARG_HUMAN
[Raw transfer]




EQO_B_5(3KMZ)
RARA_HUMAN
[Raw transfer]




REA_B_2(2LBD)
RARG_HUMAN
[Raw transfer]




JYH_A_5(4JYH)
RARB_HUMAN
[Raw transfer]




EQO_A_10(3KMZ)
RARA_HUMAN
[Raw transfer]




564_A_2(1FCY)
RARG_HUMAN
[Raw transfer]




394_A_2(1EXA)
RARG_HUMAN
[Raw transfer]




JYI_A_5(4JYI)
RARB_HUMAN
[Raw transfer]




REA_J_10(1XDK)
RARB_MOUSE
[Raw transfer]




REA_A_5(4DM8)
RARB_HUMAN
[Raw transfer]




564_A_2(1FCY)
RARG_HUMAN
[Raw transfer]




REA_J_10(1XDK)
RARB_MOUSE
[Raw transfer]




REA_B_6(4DM8)
RARB_HUMAN
[Raw transfer]




EQN_A_3(3KMR)
RARA_HUMAN
[Raw transfer]




EQN_A_3(3KMR)
RARA_HUMAN
[Raw transfer]




961_A_2(1EXX)
RARG_HUMAN
[Raw transfer]




TTB_B_6(4DM6)
RARB_HUMAN
[Raw transfer]




REA_L_12(1XDK)
RARB_MOUSE
[Raw transfer]




LUF_C_6(4DQM)
RARA_HUMAN
[Raw transfer]




254_A_2(1FD0)
RARG_HUMAN
[Raw transfer]




TTB_B_2(1XAP)
RARB_HUMAN
[Raw transfer]




REA_B_2(3LBD)
RARG_HUMAN
[Raw transfer]




JYI_B_6(4JYI)
RARB_HUMAN
[Raw transfer]




156_A_2(1FCZ)
RARG_HUMAN
[Raw transfer]




961_B_2(4LBD)
RARG_HUMAN
[Raw transfer]




LUF_A_5(4DQM)
RARA_HUMAN
[Raw transfer]




5 PsiBlast_PDB 92.1899%-131 - C5 -1DKF 10.5 RARA_HUMAN
1 PsiBlast_PDB 91.9199%-123 - C5 -3A9E 8.2 RARA_HUMAN
34 HHSearch 91.23100%-124 - C5 -3KMR 9.9 RARA_HUMAN
6 PsiBlast_PDB 91.1699%-124 - C5 -4DQM 5.6 RARA_HUMAN
2 PsiBlast_PDB 91.0299%-124 - C5 -3KMR 9.9 RARA_HUMAN
23 PsiBlast_CBE 90.2599%-124 - C5 -4DQM 5.9 RARA_HUMAN
25 PsiBlast_CBE 88.0986%-121 - C5 -4DM6 10.2 RARB_HUMAN
26 PsiBlast_CBE 87.6785%-123 - C5 -4JYI 11.9 RARB_HUMAN
27 PsiBlast_CBE 87.2485%-123 - C5 -4JYH 10.6 RARB_HUMAN
20 PsiBlast_PDB 86.6283%-122 - C5 -1FCZ 10.0 RARG_HUMAN
24 PsiBlast_CBE 86.6086%-120 - C5 -4DM8 8.6 RARB_HUMAN
18 PsiBlast_PDB 86.6083%-123 - C5 -1FCY 10.7 RARG_HUMAN
17 PsiBlast_PDB 86.5783%-121 - C5 -1EXX 9.8 RARG_HUMAN
19 PsiBlast_PDB 86.5483%-122 - C5 -1FCX 10.6 RARG_HUMAN
11 PsiBlast_PDB 86.4785%-124 - C5 -4JYH 10.2 RARB_HUMAN
28 PsiBlast_CBE 86.4285%-119 - C5 -4JYG 11.5 RARB_HUMAN
41 HHSearch 86.3484%-125 - C5 -1FCY 10.7 RARG_HUMAN
10 PsiBlast_PDB 86.3485%-124 - C5 -4JYG 11.3 RARB_HUMAN
8 PsiBlast_PDB 86.3486%-119 - C5 -4DM6 10.2 RARB_HUMAN
12 PsiBlast_PDB 86.3285%-122 - C5 -4JYI 11.4 RARB_HUMAN
15 PsiBlast_PDB 86.1481%-119 - C5 -4LBD 10.7 RARG_HUMAN
29 PsiBlast_CBE 86.0983%-121 - C5 -1FD0 10.4 RARG_HUMAN
16 PsiBlast_PDB 86.0983%-120 - C5 -1EXA 9.7 RARG_HUMAN
22 PsiBlast_CBE 85.4185%-112 - C5 -1XDK 8.8 RARB_MOUSE
9 PsiBlast_PDB 85.2586%-118 - C5 -4DM8 8.5 RARB_HUMAN
3 PsiBlast_PDB 85.1799%-120 - C5 -3KMZ 11.5 RARA_HUMAN
4 PsiBlast_PDB 85.0885%-112 - C5 -1XDK 8.8 RARB_MOUSE
14 PsiBlast_PDB 85.0681%-113 - C5 -3LBD 8.7 RARG_HUMAN
32 HHSearch 84.6383%-112 - C5 -1XDK 8.8 RARB_MOUSE
13 PsiBlast_PDB 84.6181%-115 - C5 -2LBD 8.8 RARG_HUMAN
21 PsiBlast_CBE 84.4399%-119 - C5 -3KMZ 11.2 RARA_HUMAN
7 PsiBlast_PDB 84.2986%-121 - C5 -1XAP 10.3 RARB_HUMAN