@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00105_RORG_HUMAN: (2016-03-20 )
MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK

Atome Classification :

(35 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HC3_B_6(3L0L)

[Raw transfer]




NBH_B_7(4NIE)

[Raw transfer]




39K_C_5(4QM0)

[Raw transfer]




3SX_B_6(4WQP)

[Raw transfer]




NBH_A_5(4NIE)
RORG_HUMAN
[Raw transfer]




HC3_A_5(3L0L)
RORG_HUMAN
[Raw transfer]




3SX_A_4(4WQP)
RORG_HUMAN
[Raw transfer]




3QQ_B_8(4WLB)

[Raw transfer]




3QQ_A_5(4WLB)
RORG_HUMAN
[Raw transfer]




39K_A_3(4QM0)
RORG_HUMAN
[Raw transfer]




4D8_A_3(4S14)

[Raw transfer]




43V_A_3(4XT9)
?
[Raw transfer]




4Q3_B_6(4ZOM)

[Raw transfer]




HC2_A_3(3KYT)

[Raw transfer]




C3S_B_2(1S0X)

[Raw transfer]




HC9_A_3(3L0J)

[Raw transfer]




3SN_A_5(4WPF)
RORG_HUMAN
[Raw transfer]




4D8_A_5(4S15)
RORA_HUMAN
[Raw transfer]




4Q3_C_7(4ZOM)
?
[Raw transfer]




DGX_B_4(3B0W)

[Raw transfer]




3SN_D_6(4WPF)
RORG_HUMAN
[Raw transfer]




REA_C_3(1N4H)
RORB_RAT
[Raw transfer]




DGX_A_3(3B0W)
RORG_HUMAN
[Raw transfer]




4Q3_D_8(4ZOM)
?
[Raw transfer]




4Q3_A_5(4ZOM)
RORG_HUMAN
[Raw transfer]




ZBD_A_4(4YMQ)
?
[Raw transfer]




CLR_B_2(1N83)

[Raw transfer]




4P3_D_8(4ZJR)
?
[Raw transfer]




CLR_B_2(1N83)

[Raw transfer]




4P1_A_3(4ZJW)
RORG_HUMAN
[Raw transfer]




4P3_B_6(4ZJR)
?
[Raw transfer]




444_B_4(4NB6)

[Raw transfer]




4P3_A_5(4ZJR)

[Raw transfer]




4P3_C_7(4ZJR)
?
[Raw transfer]




444_A_3(4NB6)
RORG_HUMAN
[Raw transfer]




10 PsiBlast_PDB 87.17100%-144 - C3 -3KYT 8.3
5 PsiBlast_PDB 86.8499%-147 - C3 -4NIE 9.1 RORG_HUMAN
27 PsiBlast_CBE 86.82100%-145 - C3 -4WLB 7.5
22 PsiBlast_CBE 86.76100%-146 - C3 -4WPF 8.2 RORG_HUMAN
8 PsiBlast_PDB 86.76100%-142 - C3 -4WLB 7.4 RORG_HUMAN
1 PsiBlast_PDB 86.66100%-140 - C3 -4S14 8.2
23 PsiBlast_CBE 86.3599%-142 - C3 -4NIE 9.4
21 PsiBlast_CBE 86.35100%-136 - C3 -3L0L 8.7
3 PsiBlast_PDB 86.35100%-141 - C3 -3L0L 8.9 RORG_HUMAN
4 PsiBlast_PDB 86.18100%-143 - C3 -4WPF 7.5 RORG_HUMAN
13 PsiBlast_PDB 86.03100%-143 - C3 -4XT9 10.1 ?
11 PsiBlast_PDB 85.60100%-142 - C3 -3L0J 8.7
2 PsiBlast_PDB 85.0799%-142 - C3 -4YMQ 9.6 ?
9 PsiBlast_PDB 83.95100%-140 - C3 -4WQP 8.3 RORG_HUMAN
7 PsiBlast_PDB 83.91100%-136 - C3 -4QM0 7.1 RORG_HUMAN
24 PsiBlast_CBE 83.60100%-135 - C3 -4QM0 7.1
30 PsiBlast_CBE 82.49100%-144 - C3 -4ZOM 9.5 ?
31 PsiBlast_CBE 82.26100%-143 - C3 -4ZOM 9.4
25 PsiBlast_CBE 81.51100%-139 - C3 -4NB6 6.5
16 PsiBlast_PDB 81.49100%-136 - C3 -4ZOM 9.2 RORG_HUMAN
26 PsiBlast_CBE 81.17100%-138 - C3 -4WQP 7.9
6 PsiBlast_PDB 81.14100%-139 - C3 -4NB6 6.4 RORG_HUMAN
34 PsiBlast_CBE 80.47100%-130 - C3 -4ZJR 7.3 ?
15 PsiBlast_PDB 80.46100%-145 - C3 -4ZJW 8.9 RORG_HUMAN
12 PsiBlast_PDB 80.02100%-136 - C3 -3B0W 8.8 RORG_HUMAN
28 PsiBlast_CBE 79.55100%-135 - C3 -3B0W 9.5
32 PsiBlast_CBE 79.24100%-135 - C3 -4ZJR 8.1 ?
14 PsiBlast_PDB 79.13100%-137 - C3 -4ZJR 8.8
33 PsiBlast_CBE 78.83100%-134 - C3 -4ZJR 8.9 ?
29 PsiBlast_CBE 78.12100%-134 - C3 -4ZOM 8.7 ?
20 PsiBlast_PDB 73.8650%-138 - C3 -1N4H 6.8 RORB_RAT
18 PsiBlast_PDB 73.2752%-138 - C3 -1N83 5.1
19 PsiBlast_PDB 73.2352%-135 - C3 -1S0X 8.1
17 PsiBlast_PDB 72.7753%-138 - C3 -4S15 8.7 RORA_HUMAN
37 HHSearch 72.5052%-141 - C3 -1N83 5.1