@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00105_VDR_CHICK: (2016-03-20 )
MSELRGSWDEQQQSMAYLPDADMDTVAASTSLPDPAGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKAMFTCPFNGDCKITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKESLKPKLSEEQQKVIDTLLEAHHKTFDTTYSDFNKFRPPVRSKFSSRMATHSSSVVSQDFSSEDSNDVFGSDAFAAFPEPMEPQMFSNLDLSEESDESPSMNIELPHLPMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEVIMLRSNQSFTMEDMSWTCGSNDFKYKVSDVTQAGHSMDLLEPLVKFQVGLKKLNLHEEEHVLLMAICILSPDRPGVQDTSLVESIQDRLSDILQTYIRCRHPPPGSRLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPEHSMQLTPLVLEVFGNEIS

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TFY_A_2(4ITF)
VDR_HUMAN
[Raw transfer]




VHW_A_2(3VHW)
VDR_HUMAN
[Raw transfer]




O1C_B_2(2HB7)
VDR_HUMAN
[Raw transfer]




TEY_A_2(4ITE)
VDR_HUMAN
[Raw transfer]




TX5_B_2(1TXI)
VDR_HUMAN
[Raw transfer]




OCC_B_2(2HAR)
VDR_HUMAN
[Raw transfer]




C3O_B_2(2HAS)
VDR_HUMAN
[Raw transfer]




MVD_B_2(2HB8)
VDR_HUMAN
[Raw transfer]




COV_A_2(3CS4)
VDR_HUMAN
[Raw transfer]




EB1_B_2(1S0Z)
VDR_HUMAN
[Raw transfer]




CA9_A_2(3AUQ)
VDR_HUMAN
[Raw transfer]




C33_B_2(2HAM)
VDR_HUMAN
[Raw transfer]




23R_X_2(3A40)
VDR_HUMAN
[Raw transfer]




MC9_B_2(1S19)
VDR_HUMAN
[Raw transfer]




3AJ_A_2(3WWR)
VDR_HUMAN
[Raw transfer]




2MV_X_2(3A3Z)
VDR_HUMAN
[Raw transfer]




CA9_A_2(3AUR)
VDR_HUMAN
[Raw transfer]




MCZ_A_2(3B0T)
VDR_HUMAN
[Raw transfer]




EIM_A_2(3AX8)
VDR_HUMAN
[Raw transfer]




0CO_A_2(3CS6)
VDR_HUMAN
[Raw transfer]




VD4_A_3(2O4J)
VDR_RAT
[Raw transfer]




3EV_A_2(3A78)
VDR_HUMAN
[Raw transfer]




12 PsiBlast_PDB 83.6669%-109 - C1 -3A40 11.6 VDR_HUMAN
8 PsiBlast_PDB 83.2569%-108 - C1 -2HB8 11.2 VDR_HUMAN
11 PsiBlast_PDB 83.1369%-108 - C1 -3A3Z 11.6 VDR_HUMAN
3 PsiBlast_PDB 82.5069%-112 - C1 -1TXI 10.2 VDR_HUMAN
20 PsiBlast_PDB 82.3969%-111 - C1 -3WWR 11.8 VDR_HUMAN
7 PsiBlast_PDB 82.1869%-107 - C1 -2HB7 12.1 VDR_HUMAN
10 PsiBlast_PDB 82.1269%-107 - C1 -3CS6 11.0 VDR_HUMAN
9 PsiBlast_PDB 81.9469%-107 - C1 -3CS4 11.2 VDR_HUMAN
2 PsiBlast_PDB 81.8069%-111 - C1 -1S19 10.5 VDR_HUMAN
5 PsiBlast_PDB 81.6569%-109 - C1 -2HAR 12.2 VDR_HUMAN
1 PsiBlast_PDB 81.6169%-110 - C1 -1S0Z 11.4 VDR_HUMAN
6 PsiBlast_PDB 81.2769%-107 - C1 -2HAS 11.9 VDR_HUMAN
4 PsiBlast_PDB 81.1069%-107 - C1 -2HAM 11.9 VDR_HUMAN
15 PsiBlast_PDB 80.9669%-111 - C1 -3AUR 10.8 VDR_HUMAN
16 PsiBlast_PDB 80.8869%-110 - C1 -3AX8 11.0 VDR_HUMAN
13 PsiBlast_PDB 80.7969%-108 - C1 -3A78 10.8 VDR_HUMAN
14 PsiBlast_PDB 80.2869%-110 - C1 -3AUQ 10.9 VDR_HUMAN
17 PsiBlast_PDB 80.0969%-107 - C1 -3VHW 12.9 VDR_HUMAN
19 PsiBlast_PDB 79.7569%-110 - C1 -4ITF 13.0 VDR_HUMAN
18 PsiBlast_PDB 79.6669%-113 * C1 *4ITE 12.6 VDR_HUMAN
25 HHSearch 77.8388%-131 - C1 -3B0T 10.2 VDR_HUMAN
24 HHSearch 77.7386%-124 - C1 -2O4J 10.5 VDR_RAT