@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 5HT2C_HUMAN: (2016-01-08 )
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV

Atome Classification :

(36 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2CV_B_9(2YCW)
ADRB1_MELGA
[Raw transfer]




Y01_B_9(2Y03)
ADRB1_MELGA
[Raw transfer]




D10_C_21(2VT4)
ADRB1_MELGA
[Raw transfer]




2CV_B_9(2YCW)
ADRB1_MELGA
[Raw transfer]




SOG_B_5(2YCX)
ADRB1_MELGA
[Raw transfer]




D10_C_21(2VT4)
ADRB1_MELGA
[Raw transfer]




SOG_B_7(2YCY)
ADRB1_MELGA
[Raw transfer]




SOG_B_5(2YCX)
ADRB1_MELGA
[Raw transfer]




SOG_B_7(2YCY)
ADRB1_MELGA
[Raw transfer]




2CV_B_5(4AMI)
ADRB1_MELGA
[Raw transfer]




SOG_B_13(2VT4)
ADRB1_MELGA
[Raw transfer]




SOG_C_18(2VT4)
ADRB1_MELGA
[Raw transfer]




STE_A_3(3EML)
ENLYS_BPT4
[Raw transfer]




SOG_D_24(2VT4)
ADRB1_MELGA
[Raw transfer]




SOG_A_7(2VT4)
ADRB1_MELGA
[Raw transfer]




2CV_A_9(2Y02)
ADRB1_MELGA
[Raw transfer]




2CV_A_9(2Y01)
ADRB1_MELGA
[Raw transfer]




SOG_B_8(2YCY)
ADRB1_MELGA
[Raw transfer]




2CV_B_16(3ZPQ)
ADRB1_MELGA
[Raw transfer]




2CV_A_9(2Y00)
ADRB1_MELGA
[Raw transfer]




2CV_B_17(4AMJ)
ADRB1_MELGA
[Raw transfer]




2CV_B_18(2Y00)
ADRB1_MELGA
[Raw transfer]




2CV_B_18(2Y04)
ADRB1_MELGA
[Raw transfer]




2CV_A_7(3ZPQ)
ADRB1_MELGA
[Raw transfer]




2CV_B_17(2Y01)
ADRB1_MELGA
[Raw transfer]




2CV_A_9(2Y04)
ADRB1_MELGA
[Raw transfer]




2CV_B_18(2Y02)
ADRB1_MELGA
[Raw transfer]




1 PsiBlast_PDB 88.1447%-144 - C4 -4IB4 - 5HT2B_HUMAN (first) -
2 PsiBlast_PDB 87.8447%-148 - C4 -4NC3 - C562_ECOLX -
78 HHSearch 86.3733%-137 - C4 -3PBL - DRD3_HUMAN (first) -
75 HHSearch 82.2529%-126 - C4 -2RH1 - ADRB2_HUMAN (first) -
3 PsiBlast_PDB 81.2928%-127 - C4 -4IAR - C562_ECOLX -
74 HHSearch 79.2626%-138 - C4 -3RZE - ENLYS_BPT4 (first) -
12 PsiBlast_PDB 77.1332%-155 - C4 -2Y03 - ADRB1_MELGA -
11 PsiBlast_PDB 76.9732%-155 - C4 -2Y02 3.1 ADRB1_MELGA
14 PsiBlast_PDB 76.7832%-151 - C4 -4AMJ - ADRB1_MELGA -
9 PsiBlast_PDB 76.7532%-155 - C4 -2Y00 3.3 ADRB1_MELGA
15 PsiBlast_PDB 76.4832%-155 - C4 -3ZPQ 2.6 ADRB1_MELGA
16 PsiBlast_PDB 76.4032%-157 - C4 -3ZPR - ADRB1_MELGA -
24 PsiBlast_CBE 76.3431%-147 - C4 -2YCW 2.6 ADRB1_MELGA
10 PsiBlast_PDB 76.1632%-156 - C4 -2Y01 3.5 ADRB1_MELGA
13 PsiBlast_PDB 76.0132%-154 - C4 -2Y04 2.2 ADRB1_MELGA
7 PsiBlast_PDB 75.8331%-148 - C4 -2YCZ - ADRB1_MELGA -
29 PsiBlast_CBE 75.8232%-153 - C4 -4AMI 2.5 ADRB1_MELGA
79 HHSearch 75.5224%-126 - C4 -3EML 5.0 ENLYS_BPT4
17 PsiBlast_PDB 75.3931%-144 - C4 -4BVN - ADRB1_MELGA -
72 HHSearch 75.3824%-132 - C4 -3UON - ACM2_HUMAN (first) -
31 PsiBlast_CBE 75.3332%-144 - C4 -3ZPQ 3.2 ADRB1_MELGA
36 PsiBlast_CBE 75.2832%-143 - C4 -2Y00 3.3 ADRB1_MELGA
32 PsiBlast_CBE 75.2032%-145 - C4 -2Y04 3.4 ADRB1_MELGA
28 PsiBlast_CBE 75.2032%-145 - C4 -4AMJ 3.9 ADRB1_MELGA
35 PsiBlast_CBE 75.1232%-145 - C4 -2Y01 3.2 ADRB1_MELGA
33 PsiBlast_CBE 75.1232%-143 - C4 -2Y03 6.5 ADRB1_MELGA
5 PsiBlast_PDB 75.1031%-146 - C4 -2YCW 3.0 ADRB1_MELGA
6 PsiBlast_PDB 75.0431%-143 - C4 -2YCX 3.1 ADRB1_MELGA
34 PsiBlast_CBE 75.0032%-144 - C4 -2Y02 3.1 ADRB1_MELGA
25 PsiBlast_CBE 74.9631%-159 - C4 -2VT4 3.1 ADRB1_MELGA
22 PsiBlast_CBE 74.7931%-145 - C4 -2YCY 3.1 ADRB1_MELGA
27 PsiBlast_CBE 74.7031%-158 - C4 -2VT4 2.4 ADRB1_MELGA
4 PsiBlast_PDB 74.6331%-158 - C4 -2VT4 2.4 ADRB1_MELGA
8 PsiBlast_PDB 74.5431%-145 - C4 -2YCY 2.6 ADRB1_MELGA
23 PsiBlast_CBE 73.8531%-144 - C4 -2YCX 2.7 ADRB1_MELGA
26 PsiBlast_CBE 72.5031%-159 - C4 -2VT4 3.0 ADRB1_MELGA