@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : AA2AR_HUMAN: (2016-01-08 )
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS

Atome Classification :

(31 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2CV_A_7(2Y04)
ADRB1_MELGA
[Raw transfer]




2CV_A_6(2Y03)
ADRB1_MELGA
[Raw transfer]




2CV_A_7(2Y00)
ADRB1_MELGA
[Raw transfer]




2CV_A_7(2Y02)
ADRB1_MELGA
[Raw transfer]




2CV_A_7(2Y01)
ADRB1_MELGA
[Raw transfer]




2CV_B_19(3ZPR)
ADRB1_MELGA
[Raw transfer]




2CV_A_12(4AMJ)
ADRB1_MELGA
[Raw transfer]




OLC_A_10(4BVN)
ADRB1_MELGA
[Raw transfer]




2CV_B_12(2Y03)
ADRB1_MELGA
[Raw transfer]




OLB_B_5(4UG2)
?
[Raw transfer]




SOG_A_5(2YDV)
?
[Raw transfer]




OLC_A_11(4BVN)
ADRB1_MELGA
[Raw transfer]




SOG_A_6(2YDV)
?
[Raw transfer]




STE_A_9(3VG9)
?
[Raw transfer]




SOG_A_7(2YDV)
?
[Raw transfer]




STE_A_7(3EML)
ENLYS_BPT4
[Raw transfer]




2CV_A_8(3ZPQ)
ADRB1_MELGA
[Raw transfer]




2CV_A_9(4AMJ)
ADRB1_MELGA
[Raw transfer]




2CV_B_9(4AMI)
ADRB1_MELGA
[Raw transfer]




68 HHSearch 97.3996%-196 - C5 -3EML 5.2 ENLYS_BPT4
4 PsiBlast_PDB 89.4397%-190 - C5 -2YDV 2.9 ?
2 PsiBlast_PDB 89.2499%-200 - C5 -3VGA - AA2AR_HUMAN -
6 PsiBlast_PDB 88.9697%-190 - C5 -4UHR - AA2AR_HUMAN -
3 PsiBlast_PDB 88.6497%-190 - C5 -2YDO - ? -
1 PsiBlast_PDB 88.3999%-199 - C5 -3VG9 2.8 ?
11 PsiBlast_PDB 88.1697%-198 - C5 -3UZC - AA2AR_HUMAN -
8 PsiBlast_PDB 87.7697%-196 - C5 -3REY - AA2AR_HUMAN -
10 PsiBlast_PDB 87.7297%-200 - C5 -3UZA - AA2AR_HUMAN -
7 PsiBlast_PDB 87.7197%-198 - C5 -3PWH - ? -
9 PsiBlast_PDB 87.3997%-195 - C5 -3RFM - AA2AR_HUMAN -
21 PsiBlast_CBE 85.8997%-205 - C5 -4UG2 5.5 ?
5 PsiBlast_PDB 85.8597%-198 - C5 -4UG2 - ? -
12 PsiBlast_PDB 71.6790%-174 - C5 -4EIY - AA2AR_HUMAN (first) -
75 HHSearch 71.0231%-163 * C5 *2RH1 - ADRB2_HUMAN (first) -
13 PsiBlast_PDB 69.7889%-188 - C5 -3EML - ENLYS_BPT4 -
14 PsiBlast_PDB 69.5189%-188 - C5 -3QAK - ENLYS_BPT4 -
23 PsiBlast_CBE 69.2335%-179 - C5 -2YCY - ADRB1_MELGA -
18 PsiBlast_PDB 68.7135%-180 - C5 -2YCZ - ADRB1_MELGA -
34 PsiBlast_CBE 68.4435%-180 - C5 -3ZPQ 1.9 ADRB1_MELGA
31 PsiBlast_CBE 68.4235%-185 - C5 -4AMI 4.5 ADRB1_MELGA
39 PsiBlast_CBE 68.2435%-181 - C5 -2Y01 2.1 ADRB1_MELGA
41 PsiBlast_CBE 68.2134%-182 - C5 -4BVN 3.8 ADRB1_MELGA
29 PsiBlast_CBE 68.1135%-181 - C5 -4AMJ 2.6 ADRB1_MELGA
32 PsiBlast_CBE 68.0435%-182 - C5 -3ZPR 2.5 ADRB1_MELGA
40 PsiBlast_CBE 67.9835%-183 - C5 -2Y00 2.4 ADRB1_MELGA
36 PsiBlast_CBE 67.6635%-181 - C5 -2Y04 2.6 ADRB1_MELGA
30 PsiBlast_CBE 67.6535%-185 - C5 -4AMJ 2.6 ADRB1_MELGA
20 PsiBlast_PDB 67.5735%-188 - C5 -2Y03 2.6 ADRB1_MELGA
37 PsiBlast_CBE 67.4635%-183 - C5 -2Y03 2.2 ADRB1_MELGA
38 PsiBlast_CBE 67.3435%-182 - C5 -2Y02 2.3 ADRB1_MELGA