@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : AA2BR_HUMAN: (2016-01-08 )
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL

Atome Classification :

(33 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLB_A_3(4UG2)
?
[Raw transfer]




2CV_A_7(2Y01)
ADRB1_MELGA
[Raw transfer]




2CV_A_7(2Y00)
ADRB1_MELGA
[Raw transfer]




2CV_A_7(2Y04)
ADRB1_MELGA
[Raw transfer]




2CV_A_12(4AMJ)
ADRB1_MELGA
[Raw transfer]




2CV_A_6(2Y03)
ADRB1_MELGA
[Raw transfer]




2CV_A_7(2Y02)
ADRB1_MELGA
[Raw transfer]




2CV_B_19(3ZPR)
ADRB1_MELGA
[Raw transfer]




OLB_B_5(4UG2)
?
[Raw transfer]




2CV_B_16(2Y00)
ADRB1_MELGA
[Raw transfer]




2CV_A_8(3ZPQ)
ADRB1_MELGA
[Raw transfer]




2CV_B_16(2Y02)
ADRB1_MELGA
[Raw transfer]




2CV_A_9(4AMJ)
ADRB1_MELGA
[Raw transfer]




2CV_B_16(2Y04)
ADRB1_MELGA
[Raw transfer]




2CV_B_12(2Y03)
ADRB1_MELGA
[Raw transfer]




2CV_B_15(2Y01)
ADRB1_MELGA
[Raw transfer]




STE_A_8(3VG9)
?
[Raw transfer]




STE_A_9(3VG9)
?
[Raw transfer]




STE_A_7(3EML)
ENLYS_BPT4
[Raw transfer]




74 HHSearch 92.4062%-171 - C2 -3EML 4.2 ENLYS_BPT4
8 PsiBlast_PDB 91.9858%-176 - C2 -3REY - AA2AR_HUMAN -
7 PsiBlast_PDB 91.6958%-175 - C2 -3PWH - ? -
10 PsiBlast_PDB 91.6658%-176 - C2 -3UZA - AA2AR_HUMAN -
11 PsiBlast_PDB 91.4658%-177 - C2 -3UZC - AA2AR_HUMAN -
4 PsiBlast_PDB 91.3459%-177 - C2 -2YDV - ? -
9 PsiBlast_PDB 91.2758%-176 - C2 -3RFM - AA2AR_HUMAN -
3 PsiBlast_PDB 91.1959%-174 - C2 -2YDO - ? -
21 PsiBlast_CBE 91.0359%-182 - C2 -4UG2 5.1 ?
2 PsiBlast_PDB 90.9260%-174 - C2 -3VGA - AA2AR_HUMAN -
6 PsiBlast_PDB 90.6059%-177 - C2 -4UHR - AA2AR_HUMAN -
5 PsiBlast_PDB 90.5459%-179 - C2 -4UG2 - ? -
1 PsiBlast_PDB 89.7060%-175 - C2 -3VG9 3.0 ?
44 PsiBlast_CBE 74.1533%-156 - C2 -2VT4 - ADRB1_MELGA -
23 PsiBlast_CBE 74.0733%-154 - C2 -4AMI - ADRB1_MELGA -
33 PsiBlast_CBE 73.9133%-144 - C2 -2YCZ - ADRB1_MELGA -
34 PsiBlast_CBE 73.8233%-147 - C2 -2YCZ - ADRB1_MELGA -
32 PsiBlast_CBE 73.8233%-154 - C2 -2Y00 2.0 ADRB1_MELGA
37 PsiBlast_CBE 73.7733%-144 - C2 -2YCX - ADRB1_MELGA -
35 PsiBlast_CBE 73.7633%-149 - C2 -2YCY - ADRB1_MELGA -
18 PsiBlast_PDB 73.5133%-159 - C2 -2Y03 2.3 ADRB1_MELGA
17 PsiBlast_PDB 73.4833%-159 - C2 -2Y02 2.2 ADRB1_MELGA
15 PsiBlast_PDB 73.4333%-159 - C2 -2Y00 2.2 ADRB1_MELGA
20 PsiBlast_PDB 73.0933%-154 - C2 -4AMJ 1.9 ADRB1_MELGA
22 PsiBlast_CBE 72.9733%-152 - C2 -4AMJ 2.6 ADRB1_MELGA
31 PsiBlast_CBE 72.9533%-153 - C2 -2Y01 2.2 ADRB1_MELGA
24 PsiBlast_CBE 72.9533%-152 - C2 -3ZPR 2.3 ADRB1_MELGA
26 PsiBlast_CBE 72.9133%-151 - C2 -3ZPQ 1.9 ADRB1_MELGA
19 PsiBlast_PDB 72.8133%-156 - C2 -2Y04 1.9 ADRB1_MELGA
16 PsiBlast_PDB 72.8133%-157 - C2 -2Y01 2.3 ADRB1_MELGA
28 PsiBlast_CBE 72.7933%-152 - C2 -2Y04 1.8 ADRB1_MELGA
30 PsiBlast_CBE 72.5233%-153 - C2 -2Y02 2.3 ADRB1_MELGA
29 PsiBlast_CBE 72.4633%-152 - C2 -2Y03 2.0 ADRB1_MELGA