@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : ACM5_HUMAN: (2016-01-08 )
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

QNB_A_2(3UON)
ACM2_HUMAN
[Raw transfer]




1 PsiBlast_PDB 94.3342% -63 - C2 -3UON 8.7 ACM2_HUMAN (first)
47 Fugue 77.1421% -55 - C2 -2RH1 - ADRB2_HUMAN (first) -
3 PsiBlast_PDB 76.0478%-153 - C2 -4U15 - ACM3_RAT -
21 PsiBlast_CBE 74.4178%-154 - C2 -4DAJ - ACM3_RAT (first) -
23 PsiBlast_CBE 74.2578%-157 - C2 -4DAJ - ACM3_RAT (first) -
25 PsiBlast_CBE 74.0878%-157 - C2 -4U15 - ? -
37 HHSearch 73.9022%-119 - C2 -2Z73 - OPSD_TODPA -
24 PsiBlast_CBE 73.7978%-159 - C2 -4U16 - ? -
2 PsiBlast_PDB 73.5978%-155 - C2 -4DAJ - ACM3_RAT (first) -
22 PsiBlast_CBE 73.4878%-156 - C2 -4DAJ - ACM3_RAT (first) -
48 Fugue 73.4719% -62 - C2 -3ODU - CXCR4_HUMAN (first) -
4 PsiBlast_PDB 73.2978%-156 - C2 -4U16 - ? -
5 PsiBlast_PDB 72.6878%-155 - C2 -4U14 - ENLYS_BPT4 -
28 HHSearch 70.1365%-147 - C2 -3UON - ACM2_HUMAN (first) -
17 PsiBlast_PDB 68.2530%-115 - C2 -2YCW - ADRB1_MELGA -
15 PsiBlast_PDB 67.6731%-113 - C2 -4BVN - ADRB1_MELGA -
19 PsiBlast_PDB 67.6630%-115 - C2 -2YCZ - ADRB1_MELGA -
51 Fugue 66.2018% -53 - C2 -1F88 - OPSD_BOVIN -
18 PsiBlast_PDB 66.1330%-111 - C2 -2YCX - ADRB1_MELGA -
16 PsiBlast_PDB 65.5628%-127 - C2 -4GBR - ADRB2_HUMAN -