@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : ADA1B_HUMAN: (2016-01-08 )
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF

Atome Classification :

(27 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2CV_B_9(2YCW)
ADRB1_MELGA
[Raw transfer]




Y01_A_3(2Y02)
ADRB1_MELGA
[Raw transfer]




2CV_B_9(2YCW)
ADRB1_MELGA
[Raw transfer]




D10_A_10(2VT4)
ADRB1_MELGA
[Raw transfer]




SOG_B_5(2YCX)
ADRB1_MELGA
[Raw transfer]




SOG_B_7(2YCY)
ADRB1_MELGA
[Raw transfer]




D10_C_21(2VT4)
ADRB1_MELGA
[Raw transfer]




SOG_B_5(2YCX)
ADRB1_MELGA
[Raw transfer]




D10_C_21(2VT4)
ADRB1_MELGA
[Raw transfer]




2CV_B_5(4AMI)
ADRB1_MELGA
[Raw transfer]




2CV_B_18(4AMJ)
ADRB1_MELGA
[Raw transfer]




2CV_B_19(3ZPR)
ADRB1_MELGA
[Raw transfer]




2CV_B_12(2Y03)
ADRB1_MELGA
[Raw transfer]




56 HHSearch 87.8336%-135 - C7 -2RH1 - ADRB2_HUMAN (first) -
62 HHSearch 87.3036%-137 - C7 -3PBL - DRD3_HUMAN (first) -
59 HHSearch 82.2730%-138 - C7 -3RZE - ENLYS_BPT4 (first) -
12 PsiBlast_PDB 78.1830%-148 - C7 -4IAR - C562_ECOLX -
33 PsiBlast_CBE 77.9335%-157 - C7 -2YCW 2.5 ADRB1_MELGA
24 PsiBlast_CBE 77.4636%-157 - C7 -3ZPQ - ADRB1_MELGA -
3 PsiBlast_PDB 77.4136%-169 - C7 -2Y02 4.5 ADRB1_MELGA
13 PsiBlast_PDB 77.2935%-150 - C7 -4BVN - ADRB1_MELGA -
1 PsiBlast_PDB 77.1136%-168 - C7 -2Y00 - ADRB1_MELGA -
6 PsiBlast_PDB 77.0736%-166 - C7 -3ZPR - ADRB1_MELGA -
29 PsiBlast_CBE 77.0636%-159 - C7 -2Y00 - ADRB1_MELGA -
23 PsiBlast_CBE 76.9336%-160 - C7 -3ZPR 1.8 ADRB1_MELGA
31 PsiBlast_CBE 76.9235%-153 - C7 -2YCY - ADRB1_MELGA -
26 PsiBlast_CBE 76.9136%-157 - C7 -2Y03 - ADRB1_MELGA -
10 PsiBlast_PDB 76.8035%-155 - C7 -2YCZ - ADRB1_MELGA -
34 PsiBlast_CBE 76.7535%-166 - C7 -2VT4 2.6 ADRB1_MELGA
27 PsiBlast_CBE 76.6736%-156 - C7 -2Y02 - ADRB1_MELGA -
21 PsiBlast_CBE 76.6236%-157 - C7 -4AMJ 2.5 ADRB1_MELGA
11 PsiBlast_PDB 76.6235%-155 - C7 -2YCY 2.4 ADRB1_MELGA
30 PsiBlast_CBE 76.5735%-154 - C7 -2YCZ - ADRB1_MELGA -
36 PsiBlast_CBE 76.3835%-162 - C7 -2VT4 2.6 ADRB1_MELGA
4 PsiBlast_PDB 76.0936%-168 - C7 -2Y03 2.0 ADRB1_MELGA
22 PsiBlast_CBE 75.9236%-159 - C7 -4AMI 2.0 ADRB1_MELGA
8 PsiBlast_PDB 75.7435%-154 - C7 -2YCW 2.8 ADRB1_MELGA
32 PsiBlast_CBE 75.3035%-153 - C7 -2YCX 2.6 ADRB1_MELGA
35 PsiBlast_CBE 74.2435%-164 - C7 -2VT4 3.2 ADRB1_MELGA
9 PsiBlast_PDB 73.9235%-150 - C7 -2YCX 3.7 ADRB1_MELGA