@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : TAAR1_HUMAN: (2016-01-15 )
MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SOG_B_5(2YCX)
ADRB1_MELGA
[Raw transfer]




67 Fugue 95.7231%-143 * C5 *2RH1 - ADRB2_HUMAN (first) -
50 HHSearch 95.0932%-138 - C5 -2RH1 - ADRB2_HUMAN (first) -
24 PsiBlast_CBE 94.0234%-146 - C5 -2YCW - ADRB1_MELGA -
11 PsiBlast_PDB 93.7133%-148 - C5 -4AMJ - ADRB1_MELGA -
12 PsiBlast_PDB 93.3833%-148 - C5 -3ZPQ - ADRB1_MELGA -
7 PsiBlast_PDB 92.9433%-151 - C5 -2Y01 - ADRB1_MELGA -
13 PsiBlast_PDB 92.7533%-147 - C5 -3ZPR - ADRB1_MELGA -
22 PsiBlast_CBE 92.1734%-142 - C5 -2YCY - ADRB1_MELGA -
8 PsiBlast_PDB 92.1033%-148 - C5 -2Y02 - ADRB1_MELGA -
6 PsiBlast_PDB 92.1033%-151 - C5 -2Y00 - ADRB1_MELGA -
10 PsiBlast_PDB 91.9733%-152 - C5 -2Y04 - ADRB1_MELGA -
5 PsiBlast_PDB 91.8134%-144 - C5 -2YCY - ADRB1_MELGA -
2 PsiBlast_PDB 91.8134%-143 - C5 -2YCW - ADRB1_MELGA -
34 PsiBlast_CBE 91.7933%-142 - C5 -2Y02 - ADRB1_MELGA -
32 PsiBlast_CBE 91.7733%-143 - C5 -2Y04 - ADRB1_MELGA -
28 PsiBlast_CBE 91.7533%-141 - C5 -4AMJ - ADRB1_MELGA -
25 PsiBlast_CBE 91.7334%-149 - C5 -2VT4 - ADRB1_MELGA -
36 PsiBlast_CBE 91.7233%-143 - C5 -2Y00 - ADRB1_MELGA -
4 PsiBlast_PDB 91.6034%-145 - C5 -2YCZ - ADRB1_MELGA -
29 PsiBlast_CBE 91.5633%-146 - C5 -4AMI - ADRB1_MELGA -
23 PsiBlast_CBE 91.0534%-144 - C5 -2YCX 3.8 ADRB1_MELGA