@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : ACVR1_HUMAN: (2014-10-16 )
MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC

Atome Classification :

(27 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

QIG_A_2(3GXL)
TGFR1_HUMAN
[Raw transfer]




ZZG_A_2(2WOT)
TGFR1_HUMAN
[Raw transfer]




855_A_2(3HMM)
TGFR1_HUMAN
[Raw transfer]




LDN_C_20(3Q4U)
ACVR1_HUMAN
[Raw transfer]




LDN_B_13(3Q4U)
ACVR1_HUMAN
[Raw transfer]




IYZ_A_4(4DYM)
ACVR1_HUMAN
[Raw transfer]




855_A_2(3HMM)
TGFR1_HUMAN
[Raw transfer]




844_C_14(4BGG)
ACVR1_HUMAN
[Raw transfer]




844_A_5(4BGG)
ACVR1_HUMAN
[Raw transfer]




GVD_B_10(3SOC)
AVR2A_HUMAN
[Raw transfer]




LDN_A_5(3Q4U)
ACVR1_HUMAN
[Raw transfer]




507_A_4(3OOM)
ACVR1_HUMAN
[Raw transfer]




844_B_10(4BGG)
ACVR1_HUMAN
[Raw transfer]




844_D_16(4BGG)
ACVR1_HUMAN
[Raw transfer]




085_A_2(3TZM)
TGFR1_HUMAN
[Raw transfer]




PY1_C_3(1PY5)
TGFR1_HUMAN
[Raw transfer]




ZZF_A_3(2WOU)
TGFR1_HUMAN
[Raw transfer]




A3F_A_17(3MTF)
ACVR1_HUMAN
[Raw transfer]




LDN_C_6(3MDY)
BMR1B_HUMAN
[Raw transfer]




580_B_2(1RW8)
TGFR1_HUMAN
[Raw transfer]




LDN_A_5(3MDY)
BMR1B_HUMAN
[Raw transfer]




GVD_A_3(3SOC)
AVR2A_HUMAN
[Raw transfer]




TAK_A_3(3Q4T)
AVR2A_HUMAN
[Raw transfer]




TAK_A_3(3H9R)
ACVR1_HUMAN
[Raw transfer]




TAK_B_17(3Q4T)
AVR2A_HUMAN
[Raw transfer]




6OJ_B_8(4ASX)
AVR2A_HUMAN
[Raw transfer]




6OJ_A_3(4ASX)
AVR2A_HUMAN
[Raw transfer]




ADE_A_4(2QLU)
AVR2B_HUMAN
[Raw transfer]




EDO_B_24(3Q4T)
AVR2A_HUMAN
[Raw transfer]




1 PsiBlast_PDB 95.0899%-113 - C1 -3H9R 7.8 ACVR1_HUMAN
25 PsiBlast_CBE 90.8899%-107 - C1 -3Q4U 8.9 ACVR1_HUMAN
22 PsiBlast_CBE 90.8299%-110 - C1 -4BGG 8.1 ACVR1_HUMAN
3 PsiBlast_PDB 90.4799%-107 - C1 -3OOM 7.5 ACVR1_HUMAN
26 PsiBlast_CBE 89.9999%-111 - C1 -3Q4U 8.8 ACVR1_HUMAN
2 PsiBlast_PDB 89.9399%-107 - C1 -3MTF 7.4 ACVR1_HUMAN
6 PsiBlast_PDB 89.6199%-109 - C1 -4DYM 6.6 ACVR1_HUMAN
21 PsiBlast_CBE 89.4599%-109 - C1 -4BGG 8.1 ACVR1_HUMAN
5 PsiBlast_PDB 89.3499%-108 - C1 -4BGG 8.0 ACVR1_HUMAN
4 PsiBlast_PDB 89.1699%-109 - C1 -3Q4U 8.6 ACVR1_HUMAN
23 PsiBlast_CBE 89.0699%-109 - C1 -4BGG 8.2 ACVR1_HUMAN
15 PsiBlast_PDB 84.6566%-109 - C1 -2WOU 6.3 TGFR1_HUMAN
14 PsiBlast_PDB 84.1866%-107 - C1 -2WOT 9.2 TGFR1_HUMAN
17 PsiBlast_PDB 84.0966%-106 - C1 -3GXL 8.1 TGFR1_HUMAN
13 PsiBlast_PDB 84.0766%-106 - C1 -3TZM 7.6 TGFR1_HUMAN
82 HHSearch 83.4165%-106 - C1 -3HMM 8.1 TGFR1_HUMAN
16 PsiBlast_PDB 81.9666%-107 - C1 -1RW8 7.3 TGFR1_HUMAN
12 PsiBlast_PDB 81.5864%-101 - C1 -3MDY 8.6 BMR1B_HUMAN
65 PsiBlast_CBE 81.1164%-102 - C1 -3MDY 8.6 BMR1B_HUMAN
8 PsiBlast_PDB 78.9866%-102 - C1 -1PY5 6.1 TGFR1_HUMAN
19 PsiBlast_PDB 73.4140%-101 - C1 -3Q4T 7.7 AVR2A_HUMAN
66 PsiBlast_CBE 73.2240% -99 - C1 -4ASX 5.4 AVR2A_HUMAN
68 PsiBlast_CBE 72.8040%-100 - C1 -3SOC 7.1 AVR2A_HUMAN
67 PsiBlast_CBE 72.6140% -99 - C1 -4ASX 5.4 AVR2A_HUMAN
69 PsiBlast_CBE 72.0140%-101 - C1 -3Q4T 7.3 AVR2A_HUMAN
70 PsiBlast_CBE 71.2338% -95 - C1 -2QLU 3.0 AVR2B_HUMAN
20 PsiBlast_PDB 71.1540% -97 - C1 -3SOC 7.2 AVR2A_HUMAN