@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : CDK5_HUMAN: (2013-07-19 )
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP

Atome Classification :

(89 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EZV_C_8(3F5X)
CDK2_HUMAN
[Raw transfer]




EZV_A_6(3F5X)
CDK2_HUMAN
[Raw transfer]




CDK_A_2(2XMY)
CDK2_HUMAN
[Raw transfer]




NS9_A_2(3NS9)
CDK2_HUMAN
[Raw transfer]




FRV_A_3(2W06)
CDK2_HUMAN
[Raw transfer]




CK7_C_8(2WEV)
CDK2_HUMAN
[Raw transfer]




L0H_A_2(2W1H)
CDK2_HUMAN
[Raw transfer]




FRT_A_2(2W05)
CDK2_HUMAN
[Raw transfer]




38R_A_2(3ZDU)
CDKL3_HUMAN
[Raw transfer]




3O0_B_5(3O0G)
CDK5_HUMAN
[Raw transfer]




MTZ_A_7(2UUE)
CDK2_HUMAN
[Raw transfer]




5BP_A_5(3EJ1)
CDK2_HUMAN
[Raw transfer]




LZ8_A_2(2VTO)
CDK2_HUMAN
[Raw transfer]




CK7_A_7(2WEV)
CDK2_HUMAN
[Raw transfer]




5BP_C_6(3EJ1)
CDK2_HUMAN
[Raw transfer]




3TI_A_2(3TIZ)
CDK2_HUMAN
[Raw transfer]




0BX_A_2(3UNJ)
CDK2_HUMAN
[Raw transfer]




Y8L_A_2(2XNB)
CDK2_HUMAN
[Raw transfer]




X1N_A_6(2X1N)
CDK2_HUMAN
[Raw transfer]




LZC_A_2(2VTS)
CDK2_HUMAN
[Raw transfer]




A07_A_2(3LFS)
CDK2_HUMAN
[Raw transfer]




SU9_A_3(3PY1)
CDK2_HUMAN
[Raw transfer]




PVB_A_3(1V0P)
CDC2H_PLAFK
[Raw transfer]




PVB_B_4(1V0P)
CDC2H_PLAFK
[Raw transfer]




X1N_C_7(2X1N)
CDK2_HUMAN
[Raw transfer]




LZ3_A_2(2VTI)
CDK2_HUMAN
[Raw transfer]




740_A_2(2R64)
CDK2_HUMAN
[Raw transfer]




MTZ_C_8(2UUE)
CDK2_HUMAN
[Raw transfer]




0BY_A_2(3UNK)
CDK2_HUMAN
[Raw transfer]




INR_B_4(1V0O)
CDC2H_PLAFK
[Raw transfer]




A27_A_2(3LFN)
CDK2_HUMAN
[Raw transfer]




T2A_C_6(3EOC)
CDK2_HUMAN
[Raw transfer]




60K_C_8(4FX3)
CDK2_HUMAN
[Raw transfer]




ADP_A_4(3NIZ)
?
[Raw transfer]




T2A_A_5(3EOC)
CDK2_HUMAN
[Raw transfer]




C96_A_2(2UZN)
CDK2_HUMAN
[Raw transfer]




INR_A_3(1V0O)
CDC2H_PLAFK
[Raw transfer]




LZE_A_2(2VU3)
CDK2_HUMAN
[Raw transfer]




60K_A_5(4FX3)
CDK2_HUMAN
[Raw transfer]




Z3R_B_10(4AU8)
CDK5_HUMAN
[Raw transfer]




LZA_A_2(2VTQ)
CDK2_HUMAN
[Raw transfer]




SU9_A_4(3PY0)
CDK2_HUMAN
[Raw transfer]




ATP_E_5(1UA2)
CDK7_HUMAN
[Raw transfer]




B49_A_2(3TI1)
CDK2_HUMAN
[Raw transfer]




LZ9_A_2(2VTP)
CDK2_HUMAN
[Raw transfer]




X01_A_3(3QL8)
CDK2_HUMAN
[Raw transfer]




LZ5_A_2(2VTL)
CDK2_HUMAN
[Raw transfer]




ANP_C_3(1J1B)
GSK3B_HUMAN
[Raw transfer]




Z3R_A_6(4AU8)
CDK5_HUMAN
[Raw transfer]




A28_A_2(3LFQ)
CDK2_HUMAN
[Raw transfer]




C62_A_2(2UZO)
CDK2_HUMAN
[Raw transfer]




GOL_A_3(3N9X)
?
[Raw transfer]




PMU_A_2(3S2P)
CDK2_HUMAN
[Raw transfer]




JWS_A_4(3PXZ)
CDK2_HUMAN
[Raw transfer]




JWS_A_2(3PXY)
CDK2_HUMAN
[Raw transfer]




ZIP_B_2(2EXM)
CDK2_HUMAN
[Raw transfer]




LZ7_A_2(2VTN)
CDK2_HUMAN
[Raw transfer]




B98_A_2(3FZ1)
CDK2_HUMAN
[Raw transfer]




R4L_A_2(4B99)
MK07_HUMAN
[Raw transfer]




2AN_A_3(3PXQ)
CDK2_HUMAN
[Raw transfer]




LZ1_A_2(2VTA)
CDK2_HUMAN
[Raw transfer]




LIA_B_2(2FVD)
CDK2_HUMAN
[Raw transfer]




BLZ_A_5(2I40)
CDK2_HUMAN
[Raw transfer]




SAP_A_7(2PMI)
PHO85_YEAST
[Raw transfer]




C53_A_2(2V0D)
CDK2_HUMAN
[Raw transfer]




BLZ_C_6(2I40)
CDK2_HUMAN
[Raw transfer]




LZ4_A_3(2VTJ)
CDK2_HUMAN
[Raw transfer]




X07_A_3(3QQF)
CDK2_HUMAN
[Raw transfer]




LZB_A_2(2VTR)
CDK2_HUMAN
[Raw transfer]




LZ2_A_2(2VTH)
CDK2_HUMAN
[Raw transfer]




LZ6_A_2(2VTM)
CDK2_HUMAN
[Raw transfer]




EFP_A_2(3IG7)
CDK2_HUMAN
[Raw transfer]




TIY_A_14(3TIY)
CDK2_HUMAN
[Raw transfer]




42K_A_2(4FKQ)
CDK2_HUMAN
[Raw transfer]




19K_A_2(3SW7)
CDK2_HUMAN
[Raw transfer]




03K_A_2(4EK5)
CDK2_HUMAN
[Raw transfer]




10K_A_2(4EK6)
CDK2_HUMAN
[Raw transfer]




11K_A_2(4FKJ)
CDK2_HUMAN
[Raw transfer]




EFQ_A_2(3IGG)
CDK2_HUMAN
[Raw transfer]




61K_A_2(4FKV)
CDK2_HUMAN
[Raw transfer]




4CK_A_2(4FKG)
CDK2_HUMAN
[Raw transfer]




20K_A_2(4FKO)
CDK2_HUMAN
[Raw transfer]




IM9_A_2(2VV9)
CDK2_HUMAN
[Raw transfer]




62K_A_2(4FKW)
CDK2_HUMAN
[Raw transfer]




I19_A_3(2W17)
CDK2_HUMAN
[Raw transfer]




2AN_A_4(3PY1)
CDK2_HUMAN
[Raw transfer]




1CK_A_2(4EK4)
CDK2_HUMAN
[Raw transfer]




2AN_A_2(3PXZ)
CDK2_HUMAN
[Raw transfer]




2AN_A_7(3PXF)
CDK2_HUMAN
[Raw transfer]




EDO_A_10(3TIZ)
CDK2_HUMAN
[Raw transfer]




IMD_B_11(4AU8)
CDK5_HUMAN
[Raw transfer]




45K_A_2(4FKR)
CDK2_HUMAN
[Raw transfer]




EDO_A_2(3PY0)
CDK2_HUMAN
[Raw transfer]




DTT_A_6(4FX3)
CDK2_HUMAN
[Raw transfer]




EDO_A_2(3PY1)
CDK2_HUMAN
[Raw transfer]




23 PsiBlast_CBE 93.42100%-116 - C1 -4AU8 4.9 CDK5_HUMAN
118 HHSearch 93.09100%-113 - C1 -4AU8 4.9 CDK5_HUMAN
21 PsiBlast_CBE 91.4299%-125 - C1 -3O0G 6.5 CDK5_HUMAN
87 PsiBlast_CBE 84.6059%-113 - C1 -2VTA 3.1 CDK2_HUMAN
76 PsiBlast_CBE 84.1459%-115 - C1 -2VTS 6.3 CDK2_HUMAN
72 PsiBlast_CBE 84.0459%-114 - C1 -2W06 7.3 CDK2_HUMAN
64 PsiBlast_CBE 83.9559%-114 - C1 -2XNB 7.6 CDK2_HUMAN
52 PsiBlast_CBE 83.7759%-117 - C1 -3LFS 5.6 CDK2_HUMAN
65 PsiBlast_CBE 83.4859%-114 - C1 -2XMY 6.4 CDK2_HUMAN
57 PsiBlast_CBE 83.4859%-112 - C1 -3FZ1 3.8 CDK2_HUMAN
20 PsiBlast_PDB 83.4359%-115 - C1 -3QQF 4.6 CDK2_HUMAN
45 PsiBlast_CBE 83.4059%-117 - C1 -3TIZ 5.2 CDK2_HUMAN
83 PsiBlast_CBE 83.2959%-113 - C1 -2VTL 3.5 CDK2_HUMAN
46 PsiBlast_CBE 83.1959%-116 - C1 -3TIY 3.8 CDK2_HUMAN
54 PsiBlast_CBE 83.1559%-114 - C1 -3LFN 8.0 CDK2_HUMAN
70 PsiBlast_CBE 83.0859%-112 - C1 -2W1H 6.7 CDK2_HUMAN
27 PsiBlast_CBE 83.0760%-113 - C1 -1V0P 8.2 CDC2H_PLAFK
86 PsiBlast_CBE 83.0059%-116 - C1 -2VTH 3.4 CDK2_HUMAN
99 PsiBlast_CBE 82.9459%-117 - C1 -2I40 8.0 CDK2_HUMAN
51 PsiBlast_CBE 82.9359%-118 - C1 -3NS9 7.5 CDK2_HUMAN
19 PsiBlast_PDB 82.8759%-110 - C1 -3QL8 5.1 CDK2_HUMAN
77 PsiBlast_CBE 82.8659%-113 - C1 -2VTR 5.3 CDK2_HUMAN
80 PsiBlast_CBE 82.8359%-113 - C1 -2VTO 4.8 CDK2_HUMAN
93 PsiBlast_CBE 82.8159%-118 - C1 -2R64 4.8 CDK2_HUMAN
89 PsiBlast_CBE 82.7859%-116 - C1 -2UZO 5.1 CDK2_HUMAN
82 PsiBlast_CBE 82.7159%-115 - C1 -2VTM 3.3 CDK2_HUMAN
50 PsiBlast_CBE 82.6659%-115 - C1 -3S2P 4.2 CDK2_HUMAN
15 PsiBlast_PDB 82.6259%-108 - C1 -3PXY 5.4 CDK2_HUMAN
53 PsiBlast_CBE 82.4959%-118 - C1 -3LFQ 5.8 CDK2_HUMAN
88 PsiBlast_CBE 82.4759%-116 - C1 -2V0D 2.4 CDK2_HUMAN
101 PsiBlast_CBE 82.4159%-113 - C1 -2EXM 4.2 CDK2_HUMAN
85 PsiBlast_CBE 82.3059%-117 - C1 -2VTI 5.2 CDK2_HUMAN
79 PsiBlast_CBE 82.3059%-116 - C1 -2VTP 4.8 CDK2_HUMAN
17 PsiBlast_PDB 82.2959%-107 - C1 -3PY0 5.6 CDK2_HUMAN
73 PsiBlast_CBE 82.2559%-115 - C1 -2W05 7.2 CDK2_HUMAN
62 PsiBlast_CBE 82.2359%-112 - C1 -3EJ1 5.8 CDK2_HUMAN
90 PsiBlast_CBE 82.1359%-116 - C1 -2UZN 4.5 CDK2_HUMAN
12 PsiBlast_PDB 81.9759%-110 - C1 -3PXF 4.4 CDK2_HUMAN
47 PsiBlast_CBE 81.7659%-114 - C1 -3TI1 6.2 CDK2_HUMAN
43 PsiBlast_CBE 81.6259%-110 - C1 -3UNK 7.1 CDK2_HUMAN
63 PsiBlast_CBE 81.5559%-111 - C1 -3EJ1 5.9 CDK2_HUMAN
44 PsiBlast_CBE 81.4759%-114 - C1 -3UNJ 7.2 CDK2_HUMAN
16 PsiBlast_PDB 81.4259%-111 - C1 -3PXZ 5.4 CDK2_HUMAN
60 PsiBlast_CBE 81.3459%-114 - C1 -3EOC 6.1 CDK2_HUMAN
58 PsiBlast_CBE 81.3259%-113 - C1 -3F5X 8.5 CDK2_HUMAN
92 PsiBlast_CBE 81.2659%-109 - C1 -2UUE 5.4 CDK2_HUMAN
78 PsiBlast_CBE 81.2659%-112 - C1 -2VTQ 5.6 CDK2_HUMAN
13 PsiBlast_PDB 81.2159%-104 - C1 -3PXQ 5.3 CDK2_HUMAN
61 PsiBlast_CBE 81.1859%-112 - C1 -3EOC 7.2 CDK2_HUMAN
69 PsiBlast_CBE 81.0559%-110 - C1 -2WEV 6.2 CDK2_HUMAN
28 PsiBlast_CBE 81.0559%-111 - C1 -4FX3 7.0 CDK2_HUMAN
68 PsiBlast_CBE 80.9659%-111 - C1 -2WEV 6.4 CDK2_HUMAN
124 HHSearch 80.9459%-108 - C1 -3NIZ 4.3 ?
84 PsiBlast_CBE 80.9359%-111 - C1 -2VTJ 4.3 CDK2_HUMAN
59 PsiBlast_CBE 80.8459%-113 - C1 -3F5X 7.8 CDK2_HUMAN
29 PsiBlast_CBE 80.7459%-112 - C1 -4FX3 6.9 CDK2_HUMAN
98 PsiBlast_CBE 80.7059%-113 - C1 -2I40 8.1 CDK2_HUMAN
91 PsiBlast_CBE 80.4659%-109 - C1 -2UUE 6.2 CDK2_HUMAN
81 PsiBlast_CBE 80.4159%-110 - C1 -2VTN 4.2 CDK2_HUMAN
18 PsiBlast_PDB 80.3459%-103 - C1 -3PY1 5.8 CDK2_HUMAN
67 PsiBlast_CBE 80.2259%-109 - C1 -2X1N 7.1 CDK2_HUMAN
66 PsiBlast_CBE 80.1859%-109 - C1 -2X1N 6.6 CDK2_HUMAN
26 PsiBlast_CBE 79.5260%-119 - C1 -1V0P 7.5 CDC2H_PLAFK
75 PsiBlast_CBE 79.2759%-108 - C1 -2VU3 6.4 CDK2_HUMAN
25 PsiBlast_CBE 79.0560%-110 - C1 -1V0O 6.2 CDC2H_PLAFK
100 PsiBlast_CBE 78.6959%-108 - C1 -2FVD 5.5 CDK2_HUMAN
24 PsiBlast_CBE 78.0960%-108 - C1 -1V0O 6.5 CDC2H_PLAFK
126 HHSearch 77.2159%-115 - C1 -2PMI 5.2 PHO85_YEAST
122 HHSearch 72.4942% -99 - C1 -3N9X 2.3 ?
135 HHSearch 71.2037%-114 - C1 -1J1B 4.4 GSK3B_HUMAN
133 HHSearch 70.5346% -95 - C1 -1UA2 5.1 CDK7_HUMAN
113 HHSearch 67.5838%-106 - C1 -4B99 8.3 MK07_HUMAN
134 HHSearch 64.0037%-103 - C1 -2FST - MK14_HUMAN
114 HHSearch 63.7536% -82 - C1 -3ZDU 7.9 CDKL3_HUMAN
71 PsiBlast_CBE 47.4959% 16 - C1 -2W17 4.4 CDK2_HUMAN
31 PsiBlast_CBE 46.8759% 16 - C1 -4FKV 3.4 CDK2_HUMAN
48 PsiBlast_CBE 46.5159% 15 - C1 -3SW7 3.5 CDK2_HUMAN
32 PsiBlast_CBE 46.4559% 18 - C1 -4FKR 4.1 CDK2_HUMAN
33 PsiBlast_CBE 46.4159% 12 - C1 -4FKQ 5.0 CDK2_HUMAN
40 PsiBlast_CBE 46.3259% 16 - C1 -4EK6 4.5 CDK2_HUMAN
35 PsiBlast_CBE 46.1259% 18 - C1 -4FKO 3.8 CDK2_HUMAN
42 PsiBlast_CBE 45.9159% 19 - C1 -4EK4 1.7 CDK2_HUMAN
55 PsiBlast_CBE 45.8659% 16 - C1 -3IGG 3.2 CDK2_HUMAN
38 PsiBlast_CBE 45.8359% 19 - C1 -4FKG 4.5 CDK2_HUMAN
37 PsiBlast_CBE 45.7259% 16 - C1 -4FKJ 3.3 CDK2_HUMAN
41 PsiBlast_CBE 45.6759% 17 - C1 -4EK5 3.2 CDK2_HUMAN
74 PsiBlast_CBE 45.6559% 13 - C1 -2VV9 4.2 CDK2_HUMAN
56 PsiBlast_CBE 45.5859% 17 - C1 -3IG7 5.0 CDK2_HUMAN
30 PsiBlast_CBE 45.3859% 17 - C1 -4FKW 2.1 CDK2_HUMAN