@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : CDK7_HUMAN: (2013-07-19 )
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

Atome Classification :

(90 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_H_8(1UA2)
CDK7_HUMAN
[Raw transfer]




EZV_C_8(3F5X)
CDK2_HUMAN
[Raw transfer]




ANP_A_5(4IC7)
MK07_HUMAN
[Raw transfer]




L0H_A_2(2W1H)
CDK2_HUMAN
[Raw transfer]




EZV_A_6(3F5X)
CDK2_HUMAN
[Raw transfer]




LZ8_A_2(2VTO)
CDK2_HUMAN
[Raw transfer]




889_A_6(2WPA)
CDK2_HUMAN
[Raw transfer]




NS9_A_2(3NS9)
CDK2_HUMAN
[Raw transfer]




889_C_7(2WPA)
CDK2_HUMAN
[Raw transfer]




LZ9_A_2(2VTP)
CDK2_HUMAN
[Raw transfer]




ATP_E_5(1UA2)
CDK7_HUMAN
[Raw transfer]




ATP_E_5(1UA2)
CDK7_HUMAN
[Raw transfer]




38R_A_2(3ZDU)
CDKL3_HUMAN
[Raw transfer]




P48_A_5(2WIH)
CDK2_HUMAN
[Raw transfer]




A07_A_2(3LFS)
CDK2_HUMAN
[Raw transfer]




ADP_A_4(3NIZ)
?
[Raw transfer]




ATP_G_7(1UA2)
CDK7_HUMAN
[Raw transfer]




ANP_C_3(1J1B)
GSK3B_HUMAN
[Raw transfer]




FRV_A_3(2W06)
CDK2_HUMAN
[Raw transfer]




740_A_2(2R64)
CDK2_HUMAN
[Raw transfer]




A27_A_2(3LFN)
CDK2_HUMAN
[Raw transfer]




ATP_F_6(1UA2)
CDK7_HUMAN
[Raw transfer]




FRT_A_2(2W05)
CDK2_HUMAN
[Raw transfer]




SBC_A_7(2BKZ)
CDK2_HUMAN
[Raw transfer]




5BP_C_6(3EJ1)
CDK2_HUMAN
[Raw transfer]




SBC_C_8(2BKZ)
CDK2_HUMAN
[Raw transfer]




3TI_A_2(3TIZ)
CDK2_HUMAN
[Raw transfer]




P49_A_5(2WIP)
CDK2_HUMAN
[Raw transfer]




514_A_7(2C4G)
CDK2_HUMAN
[Raw transfer]




MTZ_A_7(2UUE)
CDK2_HUMAN
[Raw transfer]




B49_A_2(3TI1)
CDK2_HUMAN
[Raw transfer]




LZE_A_2(2VU3)
CDK2_HUMAN
[Raw transfer]




LZA_A_2(2VTQ)
CDK2_HUMAN
[Raw transfer]




P48_C_6(2WIH)
CDK2_HUMAN
[Raw transfer]




PO5_A_5(3EID)
CDK2_HUMAN
[Raw transfer]




X1N_A_6(2X1N)
CDK2_HUMAN
[Raw transfer]




CDK_A_2(2XMY)
CDK2_HUMAN
[Raw transfer]




P49_C_6(2WIP)
CDK2_HUMAN
[Raw transfer]




514_C_8(2C4G)
CDK2_HUMAN
[Raw transfer]




5BP_A_5(3EJ1)
CDK2_HUMAN
[Raw transfer]




HDT_A_2(1OIT)
CDK2_HUMAN
[Raw transfer]




60K_C_8(4FX3)
CDK2_HUMAN
[Raw transfer]




LZ3_A_2(2VTI)
CDK2_HUMAN
[Raw transfer]




529_A_7(2BPM)
CDK2_HUMAN
[Raw transfer]




Y8L_A_2(2XNB)
CDK2_HUMAN
[Raw transfer]




CK7_A_7(2WEV)
CDK2_HUMAN
[Raw transfer]




R4L_A_2(4B99)
MK07_HUMAN
[Raw transfer]




292_C_8(1VYW)
CDK2_HUMAN
[Raw transfer]




LZC_A_2(2VTS)
CDK2_HUMAN
[Raw transfer]




A28_A_2(3LFQ)
CDK2_HUMAN
[Raw transfer]




529_C_8(2BPM)
CDK2_HUMAN
[Raw transfer]




292_A_7(1VYW)
CDK2_HUMAN
[Raw transfer]




LZ7_A_2(2VTN)
CDK2_HUMAN
[Raw transfer]




WXV_C_6(2WXV)
CDK2_HUMAN
[Raw transfer]




CMG_A_3(1E1V)
CDK2_HUMAN
[Raw transfer]




LZ5_A_2(2VTL)
CDK2_HUMAN
[Raw transfer]




LZ1_A_2(2VTA)
CDK2_HUMAN
[Raw transfer]




WXV_A_5(2WXV)
CDK2_HUMAN
[Raw transfer]




T2A_C_6(3EOC)
CDK2_HUMAN
[Raw transfer]




C62_A_2(2UZO)
CDK2_HUMAN
[Raw transfer]




T2A_A_5(3EOC)
CDK2_HUMAN
[Raw transfer]




0BX_A_2(3UNJ)
CDK2_HUMAN
[Raw transfer]




NW1_A_3(1E1X)
CDK2_HUMAN
[Raw transfer]




C96_A_2(2UZN)
CDK2_HUMAN
[Raw transfer]




BAX_A_3(3RGF)
CDK8_HUMAN
[Raw transfer]




B98_A_2(3FZ1)
CDK2_HUMAN
[Raw transfer]




C53_A_2(2V0D)
CDK2_HUMAN
[Raw transfer]




SAP_A_7(2PMI)
PHO85_YEAST
[Raw transfer]




60K_A_5(4FX3)
CDK2_HUMAN
[Raw transfer]




BLZ_C_6(2I40)
CDK2_HUMAN
[Raw transfer]




PMU_A_2(3S2P)
CDK2_HUMAN
[Raw transfer]




0BY_A_2(3UNK)
CDK2_HUMAN
[Raw transfer]




Z3R_A_6(4AU8)
CDK5_HUMAN
[Raw transfer]




LZ6_A_2(2VTM)
CDK2_HUMAN
[Raw transfer]




LZ2_A_2(2VTH)
CDK2_HUMAN
[Raw transfer]




LZ4_A_3(2VTJ)
CDK2_HUMAN
[Raw transfer]




LZB_A_2(2VTR)
CDK2_HUMAN
[Raw transfer]




MFP_A_2(1H07)
CDK2_HUMAN
[Raw transfer]




TIY_A_14(3TIY)
CDK2_HUMAN
[Raw transfer]




ATP_A_3(1B38)
CDK2_HUMAN
[Raw transfer]




0SR_A_3(4F6U)
CDK8_HUMAN
[Raw transfer]




ATP_A_3(1B39)
CDK2_HUMAN
[Raw transfer]




EFP_A_2(3IG7)
CDK2_HUMAN
[Raw transfer]




FAP_A_2(1H00)
CDK2_HUMAN
[Raw transfer]




EFQ_A_2(3IGG)
CDK2_HUMAN
[Raw transfer]




IM9_A_2(2VV9)
CDK2_HUMAN
[Raw transfer]




EDO_A_13(3TIY)
CDK2_HUMAN
[Raw transfer]




61K_A_2(4FKV)
CDK2_HUMAN
[Raw transfer]




62K_A_2(4FKW)
CDK2_HUMAN
[Raw transfer]




BYP_A_2(1H08)
CDK2_HUMAN
[Raw transfer]




EDO_A_10(3TIZ)
CDK2_HUMAN
[Raw transfer]




113 HHSearch 91.95100%-124 - C1 -1UA2 5.1 CDK7_HUMAN
22 PsiBlast_CBE 79.4899% -90 - C1 -1UA2 5.7 CDK7_HUMAN
21 PsiBlast_CBE 78.6899% -87 - C1 -1UA2 5.2 CDK7_HUMAN
59 PsiBlast_CBE 78.2744%-119 - C1 -3FZ1 3.7 CDK2_HUMAN
74 PsiBlast_CBE 77.8944%-120 - C1 -2W06 7.0 CDK2_HUMAN
82 PsiBlast_CBE 77.8544%-117 - C1 -2VTO 4.6 CDK2_HUMAN
23 PsiBlast_CBE 77.7399% -83 - C1 -1UA2 4.5 CDK7_HUMAN
95 PsiBlast_CBE 77.6444%-119 - C1 -2R64 5.0 CDK2_HUMAN
78 PsiBlast_CBE 77.5344%-119 - C1 -2VTS 6.2 CDK2_HUMAN
55 PsiBlast_CBE 77.0244%-117 - C1 -3NS9 6.5 CDK2_HUMAN
89 PsiBlast_CBE 76.9544%-116 - C1 -2VTA 3.1 CDK2_HUMAN
73 PsiBlast_CBE 76.8944%-119 - C1 -2W1H 6.7 CDK2_HUMAN
16 PsiBlast_PDB 76.7844%-115 - C1 -1E1V 4.4 CDK2_HUMAN
17 PsiBlast_PDB 76.7344%-117 - C1 -1E1X 4.5 CDK2_HUMAN
81 PsiBlast_CBE 76.6144%-120 - C1 -2VTP 4.7 CDK2_HUMAN
85 PsiBlast_CBE 76.3544%-110 - C1 -2VTL 3.4 CDK2_HUMAN
58 PsiBlast_CBE 76.3444%-118 - C1 -3LFN 7.8 CDK2_HUMAN
54 PsiBlast_CBE 76.2644%-120 - C1 -3S2P 3.9 CDK2_HUMAN
79 PsiBlast_CBE 76.2244%-110 - C1 -2VTR 5.2 CDK2_HUMAN
56 PsiBlast_CBE 76.1944%-113 - C1 -3LFS 5.9 CDK2_HUMAN
6 PsiBlast_PDB 76.1944%-112 - C1 -2WIH 8.7 CDK2_HUMAN
84 PsiBlast_CBE 76.0544%-112 - C1 -2VTM 3.4 CDK2_HUMAN
5 PsiBlast_PDB 76.0144%-113 - C1 -2BKZ 4.9 CDK2_HUMAN
68 PsiBlast_CBE 75.9444%-113 - C1 -2XMY 5.7 CDK2_HUMAN
49 PsiBlast_CBE 75.9344%-115 - C1 -3TIZ 5.5 CDK2_HUMAN
9 PsiBlast_PDB 75.9044%-115 - C1 -2WXV 7.4 CDK2_HUMAN
88 PsiBlast_CBE 75.8844%-119 - C1 -2VTH 3.3 CDK2_HUMAN
50 PsiBlast_CBE 75.8644%-114 - C1 -3TIY 3.6 CDK2_HUMAN
4 PsiBlast_PDB 75.8544%-113 - C1 -2BPM 3.6 CDK2_HUMAN
3 PsiBlast_PDB 75.8244%-112 - C1 -2C4G 5.4 CDK2_HUMAN
57 PsiBlast_CBE 75.8044%-115 - C1 -3LFQ 5.8 CDK2_HUMAN
8 PsiBlast_PDB 75.7144%-111 - C1 -2WPA 6.0 CDK2_HUMAN
27 PsiBlast_CBE 75.7044%-116 - C1 -2WIH 8.2 CDK2_HUMAN
25 PsiBlast_CBE 75.6444%-116 - C1 -2WPA 5.9 CDK2_HUMAN
28 PsiBlast_CBE 75.6144%-115 - C1 -2C4G 5.1 CDK2_HUMAN
87 PsiBlast_CBE 75.5844%-122 - C1 -2VTI 4.8 CDK2_HUMAN
60 PsiBlast_CBE 75.4944%-115 - C1 -3F5X 8.4 CDK2_HUMAN
90 PsiBlast_CBE 75.4644%-114 - C1 -2V0D 2.3 CDK2_HUMAN
80 PsiBlast_CBE 75.4144%-120 - C1 -2VTQ 5.6 CDK2_HUMAN
30 PsiBlast_CBE 75.3844%-114 - C1 -2BKZ 5.0 CDK2_HUMAN
29 PsiBlast_CBE 75.2244%-116 - C1 -2BPM 5.5 CDK2_HUMAN
2 PsiBlast_PDB 75.1544%-110 - C1 -1VYW 5.7 CDK2_HUMAN
31 PsiBlast_CBE 75.0244%-116 - C1 -1VYW 5.3 CDK2_HUMAN
86 PsiBlast_CBE 74.8744%-120 - C1 -2VTJ 3.8 CDK2_HUMAN
67 PsiBlast_CBE 74.8744%-113 - C1 -2XNB 7.6 CDK2_HUMAN
24 PsiBlast_CBE 74.7544%-116 - C1 -2WXV 6.8 CDK2_HUMAN
32 PsiBlast_CBE 74.6944%-111 - C1 -4FX3 6.4 CDK2_HUMAN
91 PsiBlast_CBE 74.6544%-117 - C1 -2UZO 5.2 CDK2_HUMAN
33 PsiBlast_CBE 74.5044%-112 - C1 -4FX3 6.5 CDK2_HUMAN
92 PsiBlast_CBE 74.4944%-122 - C1 -2UZN 4.0 CDK2_HUMAN
64 PsiBlast_CBE 74.4544%-114 - C1 -3EJ1 6.0 CDK2_HUMAN
94 PsiBlast_CBE 74.4044%-109 - C1 -2UUE 4.8 CDK2_HUMAN
66 PsiBlast_CBE 74.4044%-116 - C1 -3EID 7.3 CDK2_HUMAN
70 PsiBlast_CBE 74.3444%-111 - C1 -2X1N 6.7 CDK2_HUMAN
51 PsiBlast_CBE 74.2444%-112 - C1 -3TI1 6.1 CDK2_HUMAN
63 PsiBlast_CBE 74.2144%-114 - C1 -3EOC 6.5 CDK2_HUMAN
100 PsiBlast_CBE 74.0944%-115 - C1 -2I40 7.6 CDK2_HUMAN
61 PsiBlast_CBE 74.0544%-114 - C1 -3F5X 7.7 CDK2_HUMAN
48 PsiBlast_CBE 73.9344%-111 - C1 -3UNJ 7.0 CDK2_HUMAN
65 PsiBlast_CBE 73.9144%-113 - C1 -3EJ1 5.8 CDK2_HUMAN
72 PsiBlast_CBE 73.7944%-110 - C1 -2WEV 6.2 CDK2_HUMAN
77 PsiBlast_CBE 73.7044%-115 - C1 -2VU3 6.2 CDK2_HUMAN
62 PsiBlast_CBE 73.2744%-115 - C1 -3EOC 5.1 CDK2_HUMAN
7 PsiBlast_PDB 72.9444%-112 - C1 -2WIP 7.4 CDK2_HUMAN
26 PsiBlast_CBE 72.8744%-116 - C1 -2WIP 7.3 CDK2_HUMAN
10 PsiBlast_PDB 72.6044%-121 - C1 -1OIT 5.9 CDK2_HUMAN
83 PsiBlast_CBE 72.5444%-115 - C1 -2VTN 4.2 CDK2_HUMAN
47 PsiBlast_CBE 72.0144%-107 - C1 -3UNK 6.8 CDK2_HUMAN
128 HHSearch 71.7846%-117 - C1 -3NIZ 4.8 ?
75 PsiBlast_CBE 71.7144%-123 - C1 -2W05 7.0 CDK2_HUMAN
126 HHSearch 71.4846%-121 - C1 -4AU8 4.7 CDK5_HUMAN
129 HHSearch 70.9841%-125 - C1 -4F6U 9.1 CDK8_HUMAN
117 HHSearch 70.4740%-111 - C1 -3N9X - ?
131 HHSearch 69.8741%-131 - C1 -3RGF 9.8 CDK8_HUMAN
111 HHSearch 68.3536%-114 - C1 -4IC7 4.9 MK07_HUMAN
130 HHSearch 67.0637%-127 - C1 -1J1B 4.6 GSK3B_HUMAN
112 HHSearch 66.6936%-120 - C1 -4B99 8.0 MK07_HUMAN
132 HHSearch 65.0641%-127 - C1 -2PMI 5.2 PHO85_YEAST
127 HHSearch 64.6737%-126 - C1 -2FST - MK14_HUMAN
114 HHSearch 62.6034%-105 - C1 -3ZDU 7.8 CDKL3_HUMAN
20 PsiBlast_PDB 45.7644% -18 - C1 -1H08 3.9 CDK2_HUMAN
18 PsiBlast_PDB 45.3844% -19 - C1 -1H00 4.1 CDK2_HUMAN
19 PsiBlast_PDB 45.0944% -14 - C1 -1H07 4.1 CDK2_HUMAN
35 PsiBlast_CBE 45.0544% -18 - C1 -4FKV 3.3 CDK2_HUMAN
13 PsiBlast_PDB 44.6544% -16 - C1 -3IGG 3.6 CDK2_HUMAN
34 PsiBlast_CBE 44.2744% -17 - C1 -4FKW 0.7 CDK2_HUMAN
12 PsiBlast_PDB 43.9944% -15 - C1 -3IG7 5.0 CDK2_HUMAN
76 PsiBlast_CBE 43.9544% -20 - C1 -2VV9 4.9 CDK2_HUMAN
14 PsiBlast_PDB 43.5244% -18 - C1 -1B38 0.1 CDK2_HUMAN
15 PsiBlast_PDB 42.0944% -15 - C1 -1B39 Error CDK2_HUMAN