@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : CDK9_HUMAN: (2013-07-19 )
MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF

Atome Classification :

(99 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

T3C_A_3(4BCG)
CDK9_HUMAN
[Raw transfer]




ATP_A_4(3BLQ)
CDK9_HUMAN
[Raw transfer]




ADP_A_4(3NIZ)
?
[Raw transfer]




ADP_A_4(3NIZ)
?
[Raw transfer]




SBC_C_8(2BKZ)
CDK2_HUMAN
[Raw transfer]




EZV_A_2(3EZV)
CDK2_HUMAN
[Raw transfer]




Z62_A_2(3R8V)
CDK2_HUMAN
[Raw transfer]




38R_A_2(3ZDU)
CDKL3_HUMAN
[Raw transfer]




ANP_A_4(3MIA)
CDK9_HUMAN
[Raw transfer]




SBC_A_7(2BKZ)
CDK2_HUMAN
[Raw transfer]




ATP_E_5(1UA2)
CDK7_HUMAN
[Raw transfer]




EZR_A_2(3EZR)
CDK2_HUMAN
[Raw transfer]




Z14_A_3(3R83)
CDK2_HUMAN
[Raw transfer]




3O0_B_5(3O0G)
CDK5_HUMAN
[Raw transfer]




P48_A_5(2WIH)
CDK2_HUMAN
[Raw transfer]




07Z_A_2(3RK5)
CDK2_HUMAN
[Raw transfer]




889_A_6(2WPA)
CDK2_HUMAN
[Raw transfer]




20Z_A_2(3RMF)
CDK2_HUMAN
[Raw transfer]




99Z_A_3(3SQQ)
CDK2_HUMAN
[Raw transfer]




T9N_A_3(4BCJ)
CDK9_HUMAN
[Raw transfer]




P48_C_6(2WIH)
CDK2_HUMAN
[Raw transfer]




04Z_A_2(3RAL)
CDK2_HUMAN
[Raw transfer]




T3E_A_3(4BCI)
CDK9_HUMAN
[Raw transfer]




X64_A_6(4GCJ)
CDK2_HUMAN
[Raw transfer]




08Z_A_3(3RK7)
CDK2_HUMAN
[Raw transfer]




03Z_A_2(3RAK)
CDK2_HUMAN
[Raw transfer]




56Z_A_2(3S1H)
CDK2_HUMAN
[Raw transfer]




Z31_A_2(3R8U)
CDK2_HUMAN
[Raw transfer]




X6B_A_2(3R9D)
CDK2_HUMAN
[Raw transfer]




F18_A_3(3TNH)
CDK9_HUMAN
[Raw transfer]




SLQ_A_3(3LQ5)
CDK9_HUMAN
[Raw transfer]




Z68_A_2(3R9N)
CDK2_HUMAN
[Raw transfer]




ANP_C_3(1J1B)
GSK3B_HUMAN
[Raw transfer]




P49_A_5(2WIP)
CDK2_HUMAN
[Raw transfer]




INR_B_4(1V0O)
CDC2H_PLAFK
[Raw transfer]




889_C_7(2WPA)
CDK2_HUMAN
[Raw transfer]




X64_A_3(3QXP)
CDK2_HUMAN
[Raw transfer]




WXV_C_6(2WXV)
CDK2_HUMAN
[Raw transfer]




WXV_A_5(2WXV)
CDK2_HUMAN
[Raw transfer]




Z63_A_2(3R8Z)
CDK2_HUMAN
[Raw transfer]




26Z_A_3(3RPV)
CDK2_HUMAN
[Raw transfer]




X85_A_3(3RAI)
CDK2_HUMAN
[Raw transfer]




Z67_A_2(3R9H)
CDK2_HUMAN
[Raw transfer]




BAX_A_3(3RGF)
CDK8_HUMAN
[Raw transfer]




514_A_7(2C4G)
CDK2_HUMAN
[Raw transfer]




514_C_8(2C4G)
CDK2_HUMAN
[Raw transfer]




Z71_A_2(3R9O)
CDK2_HUMAN
[Raw transfer]




09Z_A_2(3RK9)
CDK2_HUMAN
[Raw transfer]




O1Z_A_2(3RAH)
CDK2_HUMAN
[Raw transfer]




X66_A_2(3QZF)
CDK2_HUMAN
[Raw transfer]




P49_C_6(2WIP)
CDK2_HUMAN
[Raw transfer]




25Z_A_2(3RPR)
CDK2_HUMAN
[Raw transfer]




27Z_A_2(3RPY)
CDK2_HUMAN
[Raw transfer]




INR_A_3(1V0O)
CDC2H_PLAFK
[Raw transfer]




X87_A_3(3R73)
CDK2_HUMAN
[Raw transfer]




02Z_A_2(3RZB)
CDK2_HUMAN
[Raw transfer]




24Z_A_3(3RPO)
CDK2_HUMAN
[Raw transfer]




06Z_A_2(3RJC)
CDK2_HUMAN
[Raw transfer]




X72_A_3(3QZI)
CDK2_HUMAN
[Raw transfer]




Z46_A_2(3R8P)
CDK2_HUMAN
[Raw transfer]




X67_A_4(3QZG)
CDK2_HUMAN
[Raw transfer]




STU_A_2(4EZ7)
CDK2_HUMAN
[Raw transfer]




Z60_A_2(3S00)
CDK2_HUMAN
[Raw transfer]




12Z_A_3(3RKB)
CDK2_HUMAN
[Raw transfer]




CPB_A_6(3BLR)
CDK9_HUMAN
[Raw transfer]




X86_A_3(3R71)
CDK2_HUMAN
[Raw transfer]




PVB_B_4(1V0P)
CDC2H_PLAFK
[Raw transfer]




21Z_A_2(3RNI)
CDK2_HUMAN
[Raw transfer]




PVB_A_3(1V0P)
CDC2H_PLAFK
[Raw transfer]




Z02_A_3(3R7V)
CDK2_HUMAN
[Raw transfer]




50Z_A_2(3S0O)
CDK2_HUMAN
[Raw transfer]




292_A_7(1VYW)
CDK2_HUMAN
[Raw transfer]




Z30_A_2(3R8L)
CDK2_HUMAN
[Raw transfer]




Z04_A_3(3R7Y)
CDK2_HUMAN
[Raw transfer]




ALH_A_5(1UNG)
CDK5_HUMAN
[Raw transfer]




292_C_8(1VYW)
CDK2_HUMAN
[Raw transfer]




529_C_8(2BPM)
CDK2_HUMAN
[Raw transfer]




Z19_A_3(3R8M)
CDK2_HUMAN
[Raw transfer]




19Z_A_3(3RM7)
CDK2_HUMAN
[Raw transfer]




X69_A_3(3QZH)
CDK2_HUMAN
[Raw transfer]




X88_A_3(3R7E)
CDK2_HUMAN
[Raw transfer]




18Z_A_3(3RM6)
CDK2_HUMAN
[Raw transfer]




GOL_A_3(3N9X)
?
[Raw transfer]




RRC_A_5(1UNL)
CDK5_HUMAN
[Raw transfer]




X84_A_3(3R6X)
CDK2_HUMAN
[Raw transfer]




Z3R_B_10(4AU8)
CDK5_HUMAN
[Raw transfer]




529_A_7(2BPM)
CDK2_HUMAN
[Raw transfer]




22Z_A_3(3ROY)
CDK2_HUMAN
[Raw transfer]




Z3R_A_6(4AU8)
CDK5_HUMAN
[Raw transfer]




X76_A_3(3R1Y)
CDK2_HUMAN
[Raw transfer]




X75_A_3(3R1Q)
CDK2_HUMAN
[Raw transfer]




X73_A_3(3R1S)
CDK2_HUMAN
[Raw transfer]




X65_A_3(3QXO)
CDK2_HUMAN
[Raw transfer]




X96_A_3(3R7U)
CDK2_HUMAN
[Raw transfer]




0S0_A_2(4EZ3)
CDK2_HUMAN
[Raw transfer]




XA0_A_3(3R28)
CDK2_HUMAN
[Raw transfer]




0SR_A_3(4F6U)
CDK8_HUMAN
[Raw transfer]




RFZ_A_5(3MY1)
CDK9_HUMAN
[Raw transfer]




X9I_A_3(3R7I)
CDK2_HUMAN
[Raw transfer]




2AN_A_3(4EZ7)
CDK2_HUMAN
[Raw transfer]




EDO_A_3(4EZ3)
CDK2_HUMAN
[Raw transfer]




4 PsiBlast_PDB 95.5099%-125 - C1 -3MIA 3.8 CDK9_HUMAN
13 PsiBlast_PDB 95.0799%-131 - C1 -4BCG 6.4 CDK9_HUMAN
5 PsiBlast_PDB 94.8799%-136 - C1 -3BLQ 4.0 CDK9_HUMAN
7 PsiBlast_PDB 92.9999%-123 - C1 -3MY1 4.9 CDK9_HUMAN
8 PsiBlast_PDB 92.5199%-129 - C1 -3LQ5 6.9 CDK9_HUMAN
12 PsiBlast_PDB 92.1499%-126 - C1 -4BCJ 5.6 CDK9_HUMAN
6 PsiBlast_PDB 92.1099%-128 - C1 -3BLR 7.5 CDK9_HUMAN
11 PsiBlast_PDB 92.0699%-127 - C1 -4BCI 5.8 CDK9_HUMAN
9 PsiBlast_PDB 91.4799%-136 - C1 -3TNH 4.4 CDK9_HUMAN
131 HHSearch 66.8341%-113 - C1 -3NIZ 4.2 ?
81 PsiBlast_CBE 66.5339%-112 - C1 -3R8P 3.9 CDK2_HUMAN
122 HHSearch 66.4531%-103 - C1 -3N9X 2.3 ?
84 PsiBlast_CBE 66.3939%-111 - C1 -3R83 5.4 CDK2_HUMAN
85 PsiBlast_CBE 66.3539%-112 - C1 -3R7Y 5.3 CDK2_HUMAN
91 PsiBlast_CBE 66.1839%-111 - C1 -3R71 5.3 CDK2_HUMAN
53 PsiBlast_CBE 66.1839%-112 - C1 -3S0O 4.7 CDK2_HUMAN
78 PsiBlast_CBE 66.1139%-113 - C1 -3R8Z 4.2 CDK2_HUMAN
59 PsiBlast_CBE 66.0339%-111 - C1 -3RPO 5.3 CDK2_HUMAN
72 PsiBlast_CBE 65.7939%-109 - C1 -3RAI 5.2 CDK2_HUMAN
89 PsiBlast_CBE 65.7639%-112 - C1 -3R7E 4.4 CDK2_HUMAN
96 PsiBlast_CBE 65.5939%-109 - C1 -3R1Q 5.5 CDK2_HUMAN
54 PsiBlast_CBE 65.5839%-110 - C1 -3S00 4.5 CDK2_HUMAN
98 PsiBlast_CBE 65.5139%-109 - C1 -3QZH 4.7 CDK2_HUMAN
26 PsiBlast_CBE 65.4440%-117 - C1 -1V0P 8.0 CDC2H_PLAFK
51 PsiBlast_CBE 65.3639%-106 - C1 -3SQQ 5.9 CDK2_HUMAN
94 PsiBlast_CBE 65.2939%-110 - C1 -3R1Y 4.3 CDK2_HUMAN
63 PsiBlast_CBE 65.2739%-113 - C1 -3RM7 5.1 CDK2_HUMAN
79 PsiBlast_CBE 65.2639%-111 - C1 -3R8V 5.4 CDK2_HUMAN
95 PsiBlast_CBE 65.2239%-109 - C1 -3R1S 5.0 CDK2_HUMAN
73 PsiBlast_CBE 65.1539%-112 - C1 -3RAH 6.5 CDK2_HUMAN
92 PsiBlast_CBE 65.1439%-108 - C1 -3R6X 5.4 CDK2_HUMAN
97 PsiBlast_CBE 65.0939%-110 - C1 -3QZI 5.3 CDK2_HUMAN
23 PsiBlast_CBE 65.0940%-118 - C1 -1V0O 6.4 CDC2H_PLAFK
102 PsiBlast_CBE 65.0139%-109 - C1 -3QXO 4.7 CDK2_HUMAN
86 PsiBlast_CBE 64.9939%-109 - C1 -3R7V 4.6 CDK2_HUMAN
93 PsiBlast_CBE 64.9539%-109 - C1 -3R28 5.8 CDK2_HUMAN
88 PsiBlast_CBE 64.8339%-112 - C1 -3R7I 4.9 CDK2_HUMAN
58 PsiBlast_CBE 64.8239%-112 - C1 -3RPR 6.9 CDK2_HUMAN
57 PsiBlast_CBE 64.7839%-109 - C1 -3RPV 6.0 CDK2_HUMAN
90 PsiBlast_CBE 64.7139%-109 - C1 -3R73 5.8 CDK2_HUMAN
80 PsiBlast_CBE 64.7139%-108 - C1 -3R8U 5.5 CDK2_HUMAN
50 PsiBlast_CBE 64.7139%-110 - C1 -4EZ3 4.3 CDK2_HUMAN
100 PsiBlast_CBE 64.6839%-108 - C1 -3QZF 4.6 CDK2_HUMAN
60 PsiBlast_CBE 64.5939%-108 - C1 -3ROY 5.5 CDK2_HUMAN
75 PsiBlast_CBE 64.5639%-111 - C1 -3R9N 5.7 CDK2_HUMAN
69 PsiBlast_CBE 64.5039%-113 - C1 -3RJC 5.9 CDK2_HUMAN
76 PsiBlast_CBE 64.4939%-111 - C1 -3R9H 5.2 CDK2_HUMAN
22 PsiBlast_CBE 64.4541%-112 - C1 -4AU8 4.9 CDK5_HUMAN
99 PsiBlast_CBE 64.3839%-110 - C1 -3QZG 4.7 CDK2_HUMAN
83 PsiBlast_CBE 64.3739%-111 - C1 -3R8L 4.6 CDK2_HUMAN
87 PsiBlast_CBE 64.3039%-111 - C1 -3R7U 5.1 CDK2_HUMAN
77 PsiBlast_CBE 64.2939%-106 - C1 -3R9D 5.7 CDK2_HUMAN
24 PsiBlast_CBE 64.2640%-115 - C1 -1V0O 6.0 CDC2H_PLAFK
39 PsiBlast_CBE 64.0839%-103 - C1 -2BKZ 4.9 CDK2_HUMAN
40 PsiBlast_CBE 63.8939%-102 - C1 -2BKZ 5.3 CDK2_HUMAN
36 PsiBlast_CBE 63.8539%-100 - C1 -2C4G 5.6 CDK2_HUMAN
74 PsiBlast_CBE 63.7939%-109 - C1 -3R9O 5.6 CDK2_HUMAN
71 PsiBlast_CBE 63.7839%-111 - C1 -3RAK 5.9 CDK2_HUMAN
68 PsiBlast_CBE 63.7539%-110 - C1 -3RK5 5.6 CDK2_HUMAN
34 PsiBlast_CBE 63.7039%-101 - C1 -2WIH 8.8 CDK2_HUMAN
38 PsiBlast_CBE 63.6639%-101 - C1 -2BPM 5.9 CDK2_HUMAN
66 PsiBlast_CBE 63.5839%-108 - C1 -3RK9 4.9 CDK2_HUMAN
29 PsiBlast_CBE 63.5339%-104 - C1 -2WPA 6.1 CDK2_HUMAN
62 PsiBlast_CBE 63.4939%-111 - C1 -3RMF 7.3 CDK2_HUMAN
19 PsiBlast_PDB 63.4139%-105 - C1 -3EZR 6.3 CDK2_HUMAN
67 PsiBlast_CBE 63.3939%-110 - C1 -3RK7 5.8 CDK2_HUMAN
70 PsiBlast_CBE 63.3839%-111 - C1 -3RAL 6.2 CDK2_HUMAN
42 PsiBlast_CBE 63.3739%-102 - C1 -1VYW 6.7 CDK2_HUMAN
48 PsiBlast_CBE 63.2739%-107 - C1 -4GCJ 5.7 CDK2_HUMAN
35 PsiBlast_CBE 63.2539%-104 - C1 -2C4G 5.5 CDK2_HUMAN
44 PsiBlast_CBE 63.2340%-112 - C1 -1UNL 7.2 CDK5_HUMAN
27 PsiBlast_CBE 63.2239%-105 - C1 -2WXV 7.1 CDK2_HUMAN
30 PsiBlast_CBE 63.1839%-101 - C1 -2WPA 6.2 CDK2_HUMAN
65 PsiBlast_CBE 63.0239%-110 - C1 -3RKB 4.9 CDK2_HUMAN
37 PsiBlast_CBE 63.0039%-105 - C1 -2BPM 5.8 CDK2_HUMAN
32 PsiBlast_CBE 62.9339%-106 - C1 -2WIP 7.3 CDK2_HUMAN
28 PsiBlast_CBE 62.9139%-101 - C1 -2WXV 7.8 CDK2_HUMAN
55 PsiBlast_CBE 62.8139%-111 - C1 -3RZB 4.5 CDK2_HUMAN
133 HHSearch 62.7542% -97 - C1 -1UA2 5.2 CDK7_HUMAN
56 PsiBlast_CBE 62.7239%-112 - C1 -3RPY 4.0 CDK2_HUMAN
82 PsiBlast_CBE 62.6639%-105 - C1 -3R8M 3.7 CDK2_HUMAN
101 PsiBlast_CBE 62.5639%-108 - C1 -3QXP 5.6 CDK2_HUMAN
52 PsiBlast_CBE 62.5539%-111 - C1 -3S1H 6.1 CDK2_HUMAN
31 PsiBlast_CBE 62.5439%-107 - C1 -2WIP 7.3 CDK2_HUMAN
61 PsiBlast_CBE 62.5339%-105 - C1 -3RNI 5.1 CDK2_HUMAN
41 PsiBlast_CBE 62.4539%-107 - C1 -1VYW 6.4 CDK2_HUMAN
20 PsiBlast_PDB 62.3239%-101 - C1 -3EZV 7.0 CDK2_HUMAN
33 PsiBlast_CBE 62.0039%-106 - C1 -2WIH 8.3 CDK2_HUMAN
64 PsiBlast_CBE 61.8339%-103 - C1 -3RM6 5.7 CDK2_HUMAN
47 PsiBlast_CBE 61.6840%-117 - C1 -1UNG 5.1 CDK5_HUMAN
17 PsiBlast_PDB 61.3841%-106 - C1 -4AU8 4.9 CDK5_HUMAN
25 PsiBlast_CBE 61.3340%-123 - C1 -1V0P 7.1 CDC2H_PLAFK
124 HHSearch 61.0436%-113 - C1 -4F6U 9.1 CDK8_HUMAN
49 PsiBlast_CBE 60.7939%-100 - C1 -4EZ7 8.9 CDK2_HUMAN
116 HHSearch 60.1235%-105 - C1 -3ZDU 7.7 CDKL3_HUMAN
43 PsiBlast_CBE 59.6640%-118 - C1 -3O0G 6.4 CDK5_HUMAN
125 HHSearch 58.0136%-115 - C1 -3RGF 9.4 CDK8_HUMAN
132 HHSearch 56.6330%-107 - C1 -1J1B 4.3 GSK3B_HUMAN
129 HHSearch 53.2433%-109 - C1 -2FST - MK14_HUMAN