@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : DYRK3_HUMAN: (2013-07-20 )
MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKRVVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGSIPLCSVLPKLIS

Atome Classification :

(19 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_A_4(3LLT)
?
[Raw transfer]




DBQ_A_2(1Z57)
CLK1_HUMAN
[Raw transfer]




ANP_C_3(1J1B)
GSK3B_HUMAN
[Raw transfer]




3RA_B_4(3RAW)
CLK3_HUMAN
[Raw transfer]




DBQ_A_2(1Z57)
CLK1_HUMAN
[Raw transfer]




3RA_A_3(3RAW)
CLK3_HUMAN
[Raw transfer]




ANP_A_7(1Q99)
SKY1_YEAST
[Raw transfer]




NR9_A_4(3NR9)
CLK2_HUMAN
[Raw transfer]




GOL_A_4(3HV3)
MK14_HUMAN
[Raw transfer]




GOL_A_3(3N9X)
?
[Raw transfer]




V25_A_2(2VAG)
CLK1_HUMAN
[Raw transfer]




V25_A_2(2WU7)
CLK3_HUMAN
[Raw transfer]




DKI_A_2(2WU6)
CLK3_HUMAN
[Raw transfer]




EDO_A_11(2X7G)
SRPK2_HUMAN
[Raw transfer]




BOG_A_3(3QUE)
MK14_HUMAN
[Raw transfer]




0OQ_A_3(4EH9)
MK14_HUMAN
[Raw transfer]




0OP_A_3(4EH8)
MK14_HUMAN
[Raw transfer]




0SJ_A_2(4EHV)
MK14_HUMAN
[Raw transfer]




BOG_A_4(3QUD)
MK14_HUMAN
[Raw transfer]




EDO_A_8(4DN5)
M3K14_HUMAN
[Raw transfer]




0SJ_A_3(4EHV)
MK14_HUMAN
[Raw transfer]




126 HHSearch 82.6237% -93 - C1 -1Z57 4.2 CLK1_HUMAN
123 HHSearch 80.4234%-112 - C1 -3N9X 2.5 ?
7 PsiBlast_PDB 79.7930%-102 - C1 -3NR9 7.2 CLK2_HUMAN
2 PsiBlast_PDB 79.0634%-101 - C1 -2VAG 5.3 CLK1_HUMAN
3 PsiBlast_PDB 78.0732% -93 - C1 -2WU6 6.6 CLK3_HUMAN
119 HHSearch 77.9633% -98 - C1 -3LLT 7.4 ?
5 PsiBlast_PDB 77.4232% -90 - C1 -3RAW 7.4 CLK3_HUMAN
4 PsiBlast_PDB 77.1932% -94 - C1 -2WU7 5.6 CLK3_HUMAN
21 PsiBlast_CBE 76.6332% -91 - C1 -3RAW 5.8 CLK3_HUMAN
132 HHSearch 74.8436%-126 * C1 *2FST - MK14_HUMAN
131 HHSearch 73.6933%-110 - C1 -1J1B 3.9 GSK3B_HUMAN
15 PsiBlast_PDB 71.0230% -88 - C1 -1Q99 5.9 SKY1_YEAST
79 PsiBlast_CBE 68.4231%-101 - C1 -4EHV 4.8 MK14_HUMAN
35 PsiBlast_CBE 67.5831%-107 - C1 -3HV3 2.8 MK14_HUMAN
81 PsiBlast_CBE 66.8331%-107 - C1 -4EH8 3.5 MK14_HUMAN
34 PsiBlast_CBE 64.6231%-100 - C1 -3IW6 - MK14_HUMAN
80 PsiBlast_CBE 64.2531%-104 - C1 -4EH9 5.3 MK14_HUMAN
92 PsiBlast_CBE 64.1831% -98 - C1 -3QUE 3.6 MK14_HUMAN
93 PsiBlast_CBE 63.6931% -97 - C1 -3QUD 4.1 MK14_HUMAN