@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : DYRK4_HUMAN: (2013-07-20 )
MPASELKASEIPFHPSIKTQDPKAEEKSPKKQKVTLTAAEALKLFKNQLSPYEQSEILGYAELWFLGLEAKKLDTAPEKFSKTSFDDEHGFYLKVLHDHIAYRYEVLETIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHQQALMELKILEALRKKDKDNTYNVVHMKDFFYFRNHFCITFELLGINLYELMKNNNFQGFSLSIVRRFTLSVLKCLQMLSVEKIIHCDLKPENIVLYQKGQASVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYDVAIDMWSLGCITAELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMVLKTYDTSFLDFLRRCLVWEPSLRMTPDQALKHAWIHQSRNLKPQPRPQTLRKSNSFFPSETRKDKVQGCHHSSRKADEITKETTEKTKDSPTKHVQHSGDQQDCLQHGADTVQLPQLVDAPKKSEAAVGAEVSMTSPGQSKNFSLKNTNVLPPIV

Atome Classification :

(14 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_A_4(3LLT)
?
[Raw transfer]




ANP_A_4(3LLT)
?
[Raw transfer]




NR9_C_6(3NR9)
CLK2_HUMAN
[Raw transfer]




NR9_B_5(3NR9)
CLK2_HUMAN
[Raw transfer]




NR9_A_4(3NR9)
CLK2_HUMAN
[Raw transfer]




3RA_B_4(3RAW)
CLK3_HUMAN
[Raw transfer]




ANP_A_7(1Q99)
SKY1_YEAST
[Raw transfer]




3RA_A_3(3RAW)
CLK3_HUMAN
[Raw transfer]




ANP_C_3(1J1B)
GSK3B_HUMAN
[Raw transfer]




38R_A_2(3ZDU)
CDKL3_HUMAN
[Raw transfer]




DBQ_A_2(1Z57)
CLK1_HUMAN
[Raw transfer]




ANP_B_8(1Q99)
SKY1_YEAST
[Raw transfer]




V25_A_2(2VAG)
CLK1_HUMAN
[Raw transfer]




V25_A_2(2WU7)
CLK3_HUMAN
[Raw transfer]




DKI_A_2(2WU6)
CLK3_HUMAN
[Raw transfer]




ADE_B_13(1Q8Y)
SKY1_YEAST
[Raw transfer]




EDO_A_11(2X7G)
SRPK2_HUMAN
[Raw transfer]




1 PsiBlast_PDB 84.0733%-105 - C1 -2WU6 6.4 CLK3_HUMAN
2 PsiBlast_PDB 82.8933%-106 - C1 -2WU7 5.1 CLK3_HUMAN
21 PsiBlast_CBE 82.1333%-105 - C1 -3RAW 5.8 CLK3_HUMAN
7 PsiBlast_PDB 81.5633%-115 - C1 -1Z57 4.7 CLK1_HUMAN
3 PsiBlast_PDB 81.2733%-103 - C1 -3RAW 7.2 CLK3_HUMAN
6 PsiBlast_PDB 80.2731%-110 - C1 -3NR9 7.0 CLK2_HUMAN
23 PsiBlast_CBE 79.8131%-113 - C1 -3NR9 6.8 CLK2_HUMAN
8 PsiBlast_PDB 79.2233%-113 - C1 -2VAG 6.2 CLK1_HUMAN
22 PsiBlast_CBE 79.0631%-110 - C1 -3NR9 7.1 CLK2_HUMAN
44 HHSearch 78.2935%-101 - C1 -3LLT 7.3 ?
27 PsiBlast_CBE 77.8531% -94 - C1 -1Q8Y 4.0 SKY1_YEAST
24 PsiBlast_CBE 73.2131% -89 - C1 -1Q99 5.3 SKY1_YEAST
14 PsiBlast_PDB 72.0331% -92 - C1 -1Q99 5.8 SKY1_YEAST
57 HHSearch 71.0932%-126 - C1 -1J1B 4.6 GSK3B_HUMAN