@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : GSK3A_HUMAN: (2013-07-20 )
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLPPLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLTNSS

Atome Classification :

(54 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

03Z_A_2(3RAK)
CDK2_HUMAN
[Raw transfer]




99Z_A_3(3SQQ)
CDK2_HUMAN
[Raw transfer]




20Z_A_2(3RMF)
CDK2_HUMAN
[Raw transfer]




56Z_A_2(3S1H)
CDK2_HUMAN
[Raw transfer]




04Z_A_2(3RAL)
CDK2_HUMAN
[Raw transfer]




Z62_A_2(3R8V)
CDK2_HUMAN
[Raw transfer]




26Z_A_3(3RPV)
CDK2_HUMAN
[Raw transfer]




X64_A_6(4GCJ)
CDK2_HUMAN
[Raw transfer]




EZV_A_2(3EZV)
CDK2_HUMAN
[Raw transfer]




07Z_A_2(3RK5)
CDK2_HUMAN
[Raw transfer]




08Z_A_3(3RK7)
CDK2_HUMAN
[Raw transfer]




Z67_A_2(3R9H)
CDK2_HUMAN
[Raw transfer]




X6B_A_2(3R9D)
CDK2_HUMAN
[Raw transfer]




21Z_A_2(3RNI)
CDK2_HUMAN
[Raw transfer]




EZR_A_2(3EZR)
CDK2_HUMAN
[Raw transfer]




Z63_A_2(3R8Z)
CDK2_HUMAN
[Raw transfer]




Z31_A_2(3R8U)
CDK2_HUMAN
[Raw transfer]




06Z_A_2(3RJC)
CDK2_HUMAN
[Raw transfer]




09Z_A_2(3RK9)
CDK2_HUMAN
[Raw transfer]




ADP_A_4(3NIZ)
?
[Raw transfer]




Z68_A_2(3R9N)
CDK2_HUMAN
[Raw transfer]




25Z_A_2(3RPR)
CDK2_HUMAN
[Raw transfer]




ANP_A_5(4IC7)
MK07_HUMAN
[Raw transfer]




O1Z_A_2(3RAH)
CDK2_HUMAN
[Raw transfer]




50Z_A_2(3S0O)
CDK2_HUMAN
[Raw transfer]




Z14_A_3(3R83)
CDK2_HUMAN
[Raw transfer]




38R_A_2(3ZDU)
CDKL3_HUMAN
[Raw transfer]




ANP_C_3(1J1B)
GSK3B_HUMAN
[Raw transfer]




Z46_A_2(3R8P)
CDK2_HUMAN
[Raw transfer]




12Z_A_3(3RKB)
CDK2_HUMAN
[Raw transfer]




GOL_A_4(3N9X)
?
[Raw transfer]




Z30_A_2(3R8L)
CDK2_HUMAN
[Raw transfer]




STU_A_2(4EZ7)
CDK2_HUMAN
[Raw transfer]




Z71_A_2(3R9O)
CDK2_HUMAN
[Raw transfer]




27Z_A_2(3RPY)
CDK2_HUMAN
[Raw transfer]




19Z_A_3(3RM7)
CDK2_HUMAN
[Raw transfer]




GOL_A_3(3N9X)
?
[Raw transfer]




X86_A_3(3R71)
CDK2_HUMAN
[Raw transfer]




0S0_A_2(4EZ3)
CDK2_HUMAN
[Raw transfer]




R4L_A_2(4B99)
MK07_HUMAN
[Raw transfer]




02Z_A_2(3RZB)
CDK2_HUMAN
[Raw transfer]




Z19_A_3(3R8M)
CDK2_HUMAN
[Raw transfer]




X84_A_3(3R6X)
CDK2_HUMAN
[Raw transfer]




X76_A_3(3R1Y)
CDK2_HUMAN
[Raw transfer]




Z60_A_2(3S00)
CDK2_HUMAN
[Raw transfer]




X87_A_3(3R73)
CDK2_HUMAN
[Raw transfer]




Z04_A_3(3R7Y)
CDK2_HUMAN
[Raw transfer]




Z02_A_3(3R7V)
CDK2_HUMAN
[Raw transfer]




X88_A_3(3R7E)
CDK2_HUMAN
[Raw transfer]




X96_A_3(3R7U)
CDK2_HUMAN
[Raw transfer]




XA0_A_3(3R28)
CDK2_HUMAN
[Raw transfer]




EPE_A_4(3SD0)
GSK3B_HUMAN
[Raw transfer]




2AN_A_3(4EZ7)
CDK2_HUMAN
[Raw transfer]




EPE_A_3(1H8F)
GSK3B_HUMAN
[Raw transfer]




EPE_B_6(3SD0)
GSK3B_HUMAN
[Raw transfer]




EDO_A_3(4EZ3)
CDK2_HUMAN
[Raw transfer]




49 PsiBlast_CBE 94.0684%-130 - C1 -1H8F 2.0 GSK3B_HUMAN
45 PsiBlast_CBE 93.7086%-130 - C1 -3SD0 2.3 GSK3B_HUMAN
48 PsiBlast_CBE 93.0484%-130 - C1 -1H8F - GSK3B_HUMAN
110 HHSearch 92.0583%-132 - C1 -1J1B 4.8 GSK3B_HUMAN
46 PsiBlast_CBE 91.8886%-128 - C1 -3SD0 3.0 GSK3B_HUMAN
118 HHSearch 58.6837%-122 - C1 -3N9X 3.3 ?
52 PsiBlast_CBE 55.0835%-141 - C1 -3EZR 4.0 CDK2_HUMAN
50 PsiBlast_CBE 54.2635%-133 - C1 -3NIZ 4.4 ?
51 PsiBlast_CBE 53.9435%-139 - C1 -3EZV 4.9 CDK2_HUMAN
75 PsiBlast_CBE 53.3535%-140 - C1 -3RAL 5.4 CDK2_HUMAN
113 HHSearch 52.9234%-124 - C1 -4IC7 5.0 MK07_HUMAN
57 PsiBlast_CBE 52.5835%-136 - C1 -3S1H 5.3 CDK2_HUMAN
76 PsiBlast_CBE 52.2335%-139 - C1 -3RAK 5.0 CDK2_HUMAN
61 PsiBlast_CBE 52.2035%-138 - C1 -3RPY 4.1 CDK2_HUMAN
78 PsiBlast_CBE 51.3935%-133 - C1 -3RAH 5.8 CDK2_HUMAN
89 PsiBlast_CBE 51.3735%-134 - C1 -3R83 6.2 CDK2_HUMAN
92 PsiBlast_CBE 51.2835%-134 - C1 -3R7U 5.4 CDK2_HUMAN
66 PsiBlast_CBE 51.0935%-136 - C1 -3RNI 4.5 CDK2_HUMAN
91 PsiBlast_CBE 51.0635%-134 - C1 -3R7V 4.5 CDK2_HUMAN
63 PsiBlast_CBE 51.0535%-133 - C1 -3RPR 6.9 CDK2_HUMAN
67 PsiBlast_CBE 50.9535%-136 - C1 -3RMF 6.6 CDK2_HUMAN
96 PsiBlast_CBE 50.9335%-132 - C1 -3R71 5.7 CDK2_HUMAN
80 PsiBlast_CBE 50.7935%-133 - C1 -3R9N 5.8 CDK2_HUMAN
79 PsiBlast_CBE 50.7335%-129 - C1 -3R9O 4.9 CDK2_HUMAN
88 PsiBlast_CBE 50.5735%-133 - C1 -3R8L 4.0 CDK2_HUMAN
62 PsiBlast_CBE 50.5535%-134 - C1 -3RPV 4.9 CDK2_HUMAN
60 PsiBlast_CBE 50.5435%-135 - C1 -3RZB 4.1 CDK2_HUMAN
85 PsiBlast_CBE 50.5035%-133 - C1 -3R8U 5.0 CDK2_HUMAN
74 PsiBlast_CBE 50.4135%-134 - C1 -3RJC 4.8 CDK2_HUMAN
82 PsiBlast_CBE 50.2435%-132 - C1 -3R9D 4.7 CDK2_HUMAN
90 PsiBlast_CBE 50.2235%-132 - C1 -3R7Y 5.5 CDK2_HUMAN
83 PsiBlast_CBE 50.1935%-136 - C1 -3R8Z 3.1 CDK2_HUMAN
84 PsiBlast_CBE 50.1735%-135 - C1 -3R8V 5.0 CDK2_HUMAN
99 PsiBlast_CBE 50.1335%-132 - C1 -3R1Y 4.6 CDK2_HUMAN
95 PsiBlast_CBE 50.1235%-133 - C1 -3R73 6.0 CDK2_HUMAN
97 PsiBlast_CBE 50.1035%-132 - C1 -3R6X 6.6 CDK2_HUMAN
71 PsiBlast_CBE 50.0635%-132 - C1 -3RK9 4.5 CDK2_HUMAN
56 PsiBlast_CBE 50.0335%-135 - C1 -3SQQ 5.9 CDK2_HUMAN
94 PsiBlast_CBE 49.8335%-135 - C1 -3R7E 4.8 CDK2_HUMAN
81 PsiBlast_CBE 49.6935%-131 - C1 -3R9H 3.8 CDK2_HUMAN
70 PsiBlast_CBE 49.4935%-135 - C1 -3RKB 4.5 CDK2_HUMAN
114 HHSearch 49.4334%-120 - C1 -4B99 7.9 MK07_HUMAN
86 PsiBlast_CBE 49.3735%-131 - C1 -3R8P 3.6 CDK2_HUMAN
87 PsiBlast_CBE 49.3535%-132 - C1 -3R8M 3.2 CDK2_HUMAN
59 PsiBlast_CBE 49.2735%-133 - C1 -3S00 3.9 CDK2_HUMAN
98 PsiBlast_CBE 49.2635%-129 - C1 -3R28 6.4 CDK2_HUMAN
53 PsiBlast_CBE 49.2435%-126 - C1 -4GCJ 4.7 CDK2_HUMAN
68 PsiBlast_CBE 49.2135%-133 - C1 -3RM7 3.7 CDK2_HUMAN
55 PsiBlast_CBE 48.9035%-131 - C1 -4EZ3 3.6 CDK2_HUMAN
72 PsiBlast_CBE 48.6735%-133 - C1 -3RK7 5.2 CDK2_HUMAN
58 PsiBlast_CBE 48.1135%-133 - C1 -3S0O 4.2 CDK2_HUMAN
54 PsiBlast_CBE 47.9735%-122 - C1 -4EZ7 7.6 CDK2_HUMAN
73 PsiBlast_CBE 47.5535%-131 - C1 -3RK5 4.8 CDK2_HUMAN
115 HHSearch 40.0030%-110 - C1 -3ZDU 6.8 CDKL3_HUMAN