@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : GSK3B_HUMAN: (2013-07-20 )
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST

Atome Classification :

(44 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

20Z_A_2(3RMF)
CDK2_HUMAN
[Raw transfer]




04Z_A_2(3RAL)
CDK2_HUMAN
[Raw transfer]




99Z_A_3(3SQQ)
CDK2_HUMAN
[Raw transfer]




03Z_A_2(3RAK)
CDK2_HUMAN
[Raw transfer]




56Z_A_2(3S1H)
CDK2_HUMAN
[Raw transfer]




X64_A_6(4GCJ)
CDK2_HUMAN
[Raw transfer]




26Z_A_3(3RPV)
CDK2_HUMAN
[Raw transfer]




07Z_A_2(3RK5)
CDK2_HUMAN
[Raw transfer]




EZV_A_2(3EZV)
CDK2_HUMAN
[Raw transfer]




09Z_A_2(3RK9)
CDK2_HUMAN
[Raw transfer]




ADP_A_4(3NIZ)
?
[Raw transfer]




08Z_A_3(3RK7)
CDK2_HUMAN
[Raw transfer]




21Z_A_2(3RNI)
CDK2_HUMAN
[Raw transfer]




ANP_A_5(4IC7)
MK07_HUMAN
[Raw transfer]




27Z_A_2(3RPY)
CDK2_HUMAN
[Raw transfer]




EZR_A_2(3EZR)
CDK2_HUMAN
[Raw transfer]




06Z_A_2(3RJC)
CDK2_HUMAN
[Raw transfer]




25Z_A_2(3RPR)
CDK2_HUMAN
[Raw transfer]




ANP_C_3(1J1B)
GSK3B_HUMAN
[Raw transfer]




GOL_A_4(3N9X)
?
[Raw transfer]




38R_A_2(3ZDU)
CDKL3_HUMAN
[Raw transfer]




889_A_6(2WPA)
CDK2_HUMAN
[Raw transfer]




12Z_A_3(3RKB)
CDK2_HUMAN
[Raw transfer]




02Z_A_2(3RZB)
CDK2_HUMAN
[Raw transfer]




889_C_7(2WPA)
CDK2_HUMAN
[Raw transfer]




50Z_A_2(3S0O)
CDK2_HUMAN
[Raw transfer]




P48_A_5(2WIH)
CDK2_HUMAN
[Raw transfer]




SBC_C_8(2BKZ)
CDK2_HUMAN
[Raw transfer]




514_C_8(2C4G)
CDK2_HUMAN
[Raw transfer]




R4L_A_2(4B99)
MK07_HUMAN
[Raw transfer]




WXV_C_6(2WXV)
CDK2_HUMAN
[Raw transfer]




SBC_A_7(2BKZ)
CDK2_HUMAN
[Raw transfer]




GOL_A_3(3N9X)
?
[Raw transfer]




WXV_A_5(2WXV)
CDK2_HUMAN
[Raw transfer]




Z60_A_2(3S00)
CDK2_HUMAN
[Raw transfer]




P48_C_6(2WIH)
CDK2_HUMAN
[Raw transfer]




P49_A_5(2WIP)
CDK2_HUMAN
[Raw transfer]




P49_C_6(2WIP)
CDK2_HUMAN
[Raw transfer]




0S0_A_2(4EZ3)
CDK2_HUMAN
[Raw transfer]




STU_A_2(4EZ7)
CDK2_HUMAN
[Raw transfer]




EPE_A_4(3SD0)
GSK3B_HUMAN
[Raw transfer]




EPE_A_3(1H8F)
GSK3B_HUMAN
[Raw transfer]




2AN_A_3(4EZ7)
CDK2_HUMAN
[Raw transfer]




EPE_B_6(3SD0)
GSK3B_HUMAN
[Raw transfer]




EDO_A_3(4EZ3)
CDK2_HUMAN
[Raw transfer]




46 PsiBlast_CBE 95.08100%-129 - C1 -3SD0 2.3 GSK3B_HUMAN
49 PsiBlast_CBE 94.8999%-130 - C1 -1H8F 2.0 GSK3B_HUMAN
48 PsiBlast_CBE 94.2699%-132 - C1 -1H8F - GSK3B_HUMAN
104 HHSearch 93.16100%-130 - C1 -1J1B 4.8 GSK3B_HUMAN
47 PsiBlast_CBE 92.80100%-128 - C1 -3SD0 3.0 GSK3B_HUMAN
112 HHSearch 56.7737%-116 - C1 -3N9X 3.3 ?
107 HHSearch 54.4535%-121 - C1 -4IC7 5.0 MK07_HUMAN
53 PsiBlast_CBE 53.1833%-131 - C1 -3EZR 4.0 CDK2_HUMAN
51 PsiBlast_CBE 52.9636%-128 - C1 -3NIZ 4.4 ?
52 PsiBlast_CBE 52.6633%-129 - C1 -3EZV 4.9 CDK2_HUMAN
92 PsiBlast_CBE 52.4733%-132 - C1 -3RAL 5.5 CDK2_HUMAN
78 PsiBlast_CBE 52.2133%-130 - C1 -3RPY 4.0 CDK2_HUMAN
93 PsiBlast_CBE 51.6933%-129 - C1 -3RAK 5.1 CDK2_HUMAN
57 PsiBlast_CBE 51.4933%-116 - C1 -2WPA 5.4 CDK2_HUMAN
83 PsiBlast_CBE 51.4033%-127 - C1 -3RNI 4.6 CDK2_HUMAN
84 PsiBlast_CBE 51.3233%-128 - C1 -3RMF 6.6 CDK2_HUMAN
67 PsiBlast_CBE 51.1733%-117 - C1 -2BKZ 4.2 CDK2_HUMAN
73 PsiBlast_CBE 51.0433%-126 - C1 -3SQQ 5.4 CDK2_HUMAN
74 PsiBlast_CBE 50.9633%-128 - C1 -3S1H 5.3 CDK2_HUMAN
79 PsiBlast_CBE 50.8833%-126 - C1 -3RPV 4.9 CDK2_HUMAN
91 PsiBlast_CBE 50.5933%-126 - C1 -3RJC 4.9 CDK2_HUMAN
56 PsiBlast_CBE 50.5133%-118 - C1 -2WPA 5.4 CDK2_HUMAN
87 PsiBlast_CBE 50.4833%-128 - C1 -3RKB 4.5 CDK2_HUMAN
59 PsiBlast_CBE 50.2033%-120 - C1 -2WIP 5.9 CDK2_HUMAN
55 PsiBlast_CBE 50.0033%-119 - C1 -2WXV 6.2 CDK2_HUMAN
80 PsiBlast_CBE 49.9833%-123 - C1 -3RPR 6.7 CDK2_HUMAN
66 PsiBlast_CBE 49.8833%-116 - C1 -2BKZ 4.4 CDK2_HUMAN
76 PsiBlast_CBE 49.5233%-124 - C1 -3S00 3.9 CDK2_HUMAN
88 PsiBlast_CBE 49.4433%-124 - C1 -3RK9 4.5 CDK2_HUMAN
60 PsiBlast_CBE 49.4433%-119 - C1 -2WIH 7.1 CDK2_HUMAN
70 PsiBlast_CBE 49.2433%-119 - C1 -4GCJ 4.7 CDK2_HUMAN
108 HHSearch 49.2035%-115 - C1 -4B99 7.9 MK07_HUMAN
77 PsiBlast_CBE 49.0633%-127 - C1 -3RZB 4.2 CDK2_HUMAN
58 PsiBlast_CBE 48.9633%-123 - C1 -2WIP 5.8 CDK2_HUMAN
72 PsiBlast_CBE 48.8933%-123 - C1 -4EZ3 3.5 CDK2_HUMAN
61 PsiBlast_CBE 48.8733%-119 - C1 -2WIH 6.0 CDK2_HUMAN
89 PsiBlast_CBE 48.7833%-124 - C1 -3RK7 5.3 CDK2_HUMAN
54 PsiBlast_CBE 48.7733%-119 - C1 -2WXV 6.1 CDK2_HUMAN
90 PsiBlast_CBE 48.2833%-123 - C1 -3RK5 4.8 CDK2_HUMAN
62 PsiBlast_CBE 47.9433%-115 - C1 -2C4G 3.6 CDK2_HUMAN
119 HHSearch 46.5732%-126 - C1 -2FST - MK14_HUMAN
75 PsiBlast_CBE 46.2433%-124 - C1 -3S0O 4.2 CDK2_HUMAN
71 PsiBlast_CBE 46.2333%-114 - C1 -4EZ7 7.6 CDK2_HUMAN
109 HHSearch 40.2830%-105 - C1 -3ZDU 6.8 CDKL3_HUMAN