@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : KAPCA_HUMAN: (2013-07-21 )
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

Atome Classification :

(98 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2PY_C_3(2OH0)
KAPCA_BOVIN
[Raw transfer]




2EA_C_3(2F7E)
KAPCA_BOVIN
[Raw transfer]




4PY_C_3(2OJF)
KAPCA_BOVIN
[Raw transfer]




A67_A_2(3AGM)
KAPCA_HUMAN
[Raw transfer]

-

6EA_C_3(2F7Z)
KAPCA_BOVIN
[Raw transfer]




IQB_A_3(3VQH)
KAPCA_HUMAN
[Raw transfer]




4EA_C_3(2F7X)
KAPCA_BOVIN
[Raw transfer]




S69_A_3(3POO)
KAPCA_HUMAN
[Raw transfer]




ANP_B_11(1CDK)
KAPCA_PIG
[Raw transfer]




3SB_A_3(3OXT)
KAPCA_HUMAN
[Raw transfer]




A03_B_4(3AGL)
KAPCA_HUMAN
[Raw transfer]




A03_A_3(3AGL)
KAPCA_HUMAN
[Raw transfer]




I5S_A_3(2C1A)
KAPCA_BOVIN
[Raw transfer]




1SB_A_3(3OVV)
KAPCA_HUMAN
[Raw transfer]




R68_C_3(1XHA)
KAPCA_BOVIN
[Raw transfer]




2SB_A_3(3OWP)
KAPCA_HUMAN
[Raw transfer]




4SB_A_3(3P0M)
KAPCA_HUMAN
[Raw transfer]




R69_A_3(1XH9)
KAPCA_BOVIN
[Raw transfer]




ANP_A_7(1CDK)
KAPCA_PIG
[Raw transfer]




L20_A_3(2JDV)
KAPCA_BOVIN
[Raw transfer]




I08_C_3(1SVH)
KAPCA_BOVIN
[Raw transfer]




GOL_A_4(4IE9)
KAPCA_BOVIN
[Raw transfer]




R94_C_3(1XH6)
KAPCA_BOVIN
[Raw transfer]




B1L_B_2(1REJ)
KAPCA_MOUSE
[Raw transfer]




GOL_A_10(3ZO3)
KAPCA_BOVIN
[Raw transfer]




R68_C_3(1XH5)
KAPCA_BOVIN
[Raw transfer]




CQP_A_3(2C1B)
KAPCA_BOVIN
[Raw transfer]




R55_C_3(1XH8)
KAPCA_BOVIN
[Raw transfer]




XFE_A_7(3MVJ)
KAPCA_HUMAN
[Raw transfer]




ATP_E_3(3QAM)
KAPCA_MOUSE
[Raw transfer]




BD2_B_2(1RE8)
KAPCA_MOUSE
[Raw transfer]




ATP_E_5(3FJQ)
KAPCA_MOUSE
[Raw transfer]




L9M_B_6(3L9M)
KAPCA_HUMAN
[Raw transfer]




ANP_A_3(3FHI)
KAPCA_MOUSE
[Raw transfer]




ATP_E_3(3QAL)
KAPCA_MOUSE
[Raw transfer]




B8L_B_2(1REK)
KAPCA_MOUSE
[Raw transfer]




ANP_A_4(2R5T)
SGK1_HUMAN
[Raw transfer]




L9M_A_5(3L9M)
KAPCA_HUMAN
[Raw transfer]




IQB_E_3(1YDT)
KAPCA_BOVIN
[Raw transfer]




ATP_A_4(1Q24)
KAPCA_BOVIN
[Raw transfer]




ATP_E_5(1ATP)
KAPCA_MOUSE
[Raw transfer]




I5S_A_3(2JDT)
KAPCA_BOVIN
[Raw transfer]




L20_A_3(2JDS)
KAPCA_BOVIN
[Raw transfer]




B99_A_3(3KKV)
KAPCA_BOVIN
[Raw transfer]




QWI_A_4(3ZO4)
KAPCA_BOVIN
[Raw transfer]




RKD_A_3(4AXA)
KAPCA_BOVIN
[Raw transfer]




L9N_A_3(3L9N)
KAPCA_HUMAN
[Raw transfer]




L9L_A_5(3L9L)
KAPCA_HUMAN
[Raw transfer]




ATP_A_3(4DIN)
KAPCA_MOUSE
[Raw transfer]




STU_C_3(1STC)
KAPCA_BOVIN
[Raw transfer]




SMY_A_3(3OW3)
KAPCA_MOUSE
[Raw transfer]




ANP_E_3(4HPT)
KAPCA_MOUSE
[Raw transfer]




ANP_B_7(3O7L)
KAPCA_MOUSE
[Raw transfer]




ATP_A_2(4FG7)
KCC1A_HUMAN
[Raw transfer]




M04_A_4(2VO3)
KAPCA_BOVIN
[Raw transfer]




ANP_A_5(3IDB)
KAPCA_MOUSE
[Raw transfer]




HFS_C_3(2ERZ)
KAPCA_MOUSE
[Raw transfer]




0XZ_A_2(4GV1)
AKT1_HUMAN
[Raw transfer]




L9L_B_6(3L9L)
KAPCA_HUMAN
[Raw transfer]




ANP_A_5(3IDC)
KAPCA_MOUSE
[Raw transfer]




GVP_A_3(2UW7)
KAPCA_BOVIN
[Raw transfer]




ARX_A_2(3BWJ)
KAPCA_BOVIN
[Raw transfer]




GVJ_A_3(2UVZ)
KAPCA_BOVIN
[Raw transfer]




L15_A_3(2UW4)
KAPCA_BOVIN
[Raw transfer]




ANP_E_3(4DG3)
KAPCA_MOUSE
[Raw transfer]




07U_A_2(3TXO)

[Raw transfer]




IQS_C_3(1YDS)
KAPCA_BOVIN
[Raw transfer]




GVN_A_3(2UW5)
KAPCA_BOVIN
[Raw transfer]




R69_C_3(1XH4)
KAPCA_BOVIN
[Raw transfer]




PTV_A_3(4IJ9)
KAPCA_BOVIN
[Raw transfer]




Y27_C_3(2GNJ)
KAPCA_BOVIN
[Raw transfer]




STU_A_2(3A62)
KS6B1_HUMAN
[Raw transfer]




YTP_A_3(3OOG)
KAPCA_HUMAN
[Raw transfer]




GVK_A_3(2UW0)
KAPCA_BOVIN
[Raw transfer]




ADN_C_3(1FMO)
KAPCA_MOUSE
[Raw transfer]




LL1_A_3(3DNE)
KAPCA_BOVIN
[Raw transfer]




M05_A_4(2VO6)
KAPCA_BOVIN
[Raw transfer]




H52_C_3(2GNL)
KAPCA_BOVIN
[Raw transfer]




M77_C_3(1Q8W)
KAPCA_BOVIN
[Raw transfer]




GVI_A_3(2UVY)
KAPCA_BOVIN
[Raw transfer]




M02_A_3(2VNY)
KAPCA_BOVIN
[Raw transfer]




Y27_C_3(2GNF)
KAPCA_BOVIN
[Raw transfer]




PZX_A_3(4IE9)
KAPCA_BOVIN
[Raw transfer]




GVO_A_3(2UW6)
KAPCA_BOVIN
[Raw transfer]




GVG_A_3(2UW3)
KAPCA_BOVIN
[Raw transfer]




GVH_A_3(2UVX)
KAPCA_BOVIN
[Raw transfer]




IQP_C_3(1YDR)
KAPCA_BOVIN
[Raw transfer]




SKE_A_3(3AMA)
KAPCA_HUMAN
[Raw transfer]




QNI_A_3(3ZO3)
KAPCA_BOVIN
[Raw transfer]




XFE_E_8(3MVJ)
KAPCA_HUMAN
[Raw transfer]




M01_A_3(2VNW)
KAPCA_BOVIN
[Raw transfer]




LL2_A_3(3DND)
KAPCA_BOVIN
[Raw transfer]




ADE_A_3(4DC2)
KPCI_MOUSE
[Raw transfer]




SIJ_A_3(3ZO1)
KAPCA_BOVIN
[Raw transfer]




GVQ_A_3(2UW8)
KAPCA_BOVIN
[Raw transfer]




PEG_B_6(3O7L)
KAPCA_MOUSE
[Raw transfer]




VX6_A_3(3AMB)
KAPCA_HUMAN
[Raw transfer]




SL0_A_2(3UBD)
KS6A3_MOUSE
[Raw transfer]




BUD_B_4(3OVV)
KAPCA_HUMAN
[Raw transfer]




BUD_A_4(3POO)
KAPCA_HUMAN
[Raw transfer]




BU3_C_3(1SMH)
KAPCA_BOVIN
[Raw transfer]




0R4_A_2(4EJN)
AKT1_HUMAN
[Raw transfer]




MPD_A_3(3ZO4)
KAPCA_BOVIN
[Raw transfer]




11 PsiBlast_PDB 94.1099%-101 - C1 -3OWP 5.6 KAPCA_HUMAN
12 PsiBlast_PDB 93.9399%-102 - C1 -3OXT 6.0 KAPCA_HUMAN
13 PsiBlast_PDB 93.8599%-101 - C1 -3P0M 6.0 KAPCA_HUMAN
10 PsiBlast_PDB 93.8199%-101 - C1 -3OVV 6.7 KAPCA_HUMAN
16 PsiBlast_PDB 93.7799% -95 - C1 -3VQH 7.3 KAPCA_HUMAN
19 PsiBlast_PDB 93.4798%-102 - C1 -2VO7 - KAPCA_BOVIN
3 PsiBlast_PDB 93.4299%-107 - C1 -2F7Z 7.7 KAPCA_BOVIN
18 PsiBlast_PDB 93.3998%-103 - C1 -2C1B 6.7 KAPCA_BOVIN
14 PsiBlast_PDB 93.2499%-102 - C1 -3POO 7.1 KAPCA_HUMAN
5 PsiBlast_PDB 93.0299%-102 - C1 -2OJF 6.8 KAPCA_BOVIN
7 PsiBlast_PDB 92.9599%-100 - C1 -3AGM 9.0 KAPCA_HUMAN
9 PsiBlast_PDB 92.8999%-101 - C1 -3OOG 3.7 KAPCA_HUMAN
8 PsiBlast_PDB 92.8899%-100 - C1 -3L9L 7.8 KAPCA_HUMAN
17 PsiBlast_PDB 92.7598%-102 - C1 -2C1A 6.4 KAPCA_BOVIN
2 PsiBlast_PDB 92.6699%-100 - C1 -2F7X 7.4 KAPCA_BOVIN
1 PsiBlast_PDB 92.4099%-102 - C1 -2F7E 7.5 KAPCA_BOVIN
15 PsiBlast_PDB 92.0599% -96 - C1 -3AGL 9.8 KAPCA_HUMAN
4 PsiBlast_PDB 92.0599%-103 - C1 -2OH0 7.1 KAPCA_BOVIN
6 PsiBlast_PDB 90.8499% -97 - C1 -3MVJ 5.0 KAPCA_HUMAN
111 Fugue 82.1990% -99 - C1 -1CDK 7.7 KAPCA_PIG
26 PsiBlast_CBE 72.8698% -59 - C1 -1CDK 8.0 KAPCA_PIG
63 PsiBlast_CBE 71.4597% -55 - C1 -1SMH 2.5 KAPCA_BOVIN
77 PsiBlast_CBE 70.3097% -60 - C1 -1FMO 4.6 KAPCA_MOUSE
62 PsiBlast_CBE 70.1597% -53 - C1 -1XHA 7.7 KAPCA_BOVIN
89 PsiBlast_CBE 70.1097% -53 - C1 -3QAM 7.1 KAPCA_MOUSE
40 PsiBlast_CBE 69.8898% -60 - C1 -3DNE 5.3 KAPCA_BOVIN
35 PsiBlast_CBE 69.8498% -59 - C1 -1XH8 10.9 KAPCA_BOVIN
29 PsiBlast_CBE 69.7198% -60 - C1 -3ZO4 7.4 KAPCA_BOVIN
65 PsiBlast_CBE 69.6297% -57 - C1 -2GNF 4.5 KAPCA_BOVIN
101 PsiBlast_CBE 69.4797% -56 - C1 -3QAL 8.3 KAPCA_MOUSE
37 PsiBlast_CBE 69.4598% -58 - C1 -1XH5 9.8 KAPCA_BOVIN
30 PsiBlast_CBE 69.3798% -65 - C1 -3L9N 5.7 KAPCA_HUMAN
75 PsiBlast_CBE 69.3397% -61 - C1 -1RE8 8.5 KAPCA_MOUSE
53 PsiBlast_CBE 69.1798% -57 - C1 -2GNL 4.4 KAPCA_BOVIN
70 PsiBlast_CBE 69.1297% -55 - C1 -3IDC 5.4 KAPCA_MOUSE
23 PsiBlast_CBE 69.1299% -60 - C1 -3MVJ 4.6 KAPCA_HUMAN
71 PsiBlast_CBE 69.0997% -55 - C1 -3IDB 6.5 KAPCA_MOUSE
33 PsiBlast_CBE 69.0298% -59 - C1 -4IJ9 6.4 KAPCA_BOVIN
68 PsiBlast_CBE 68.8997% -61 - C1 -3OW3 3.2 KAPCA_MOUSE
22 PsiBlast_CBE 68.8699% -59 - C1 -3L9L 7.6 KAPCA_HUMAN
41 PsiBlast_CBE 68.7798% -59 - C1 -3DND 3.3 KAPCA_BOVIN
55 PsiBlast_CBE 68.7298% -58 - C1 -1YDT 6.8 KAPCA_BOVIN
54 PsiBlast_CBE 68.6698% -57 - C1 -2GNJ 5.0 KAPCA_BOVIN
58 PsiBlast_CBE 68.6597% -56 - C1 -2ERZ 4.1 KAPCA_MOUSE
66 PsiBlast_CBE 68.5897% -57 - C1 -4HPT 6.3 KAPCA_MOUSE
28 PsiBlast_CBE 68.4798% -58 - C1 -4IE9 4.5 KAPCA_BOVIN
73 PsiBlast_CBE 68.2197% -63 - C1 -1REK 10.8 KAPCA_MOUSE
56 PsiBlast_CBE 68.1898% -58 - C1 -1YDS 4.9 KAPCA_BOVIN
38 PsiBlast_CBE 68.1598% -57 - C1 -1SVH 9.6 KAPCA_BOVIN
44 PsiBlast_CBE 68.0698% -59 - C1 -1Q24 6.5 KAPCA_BOVIN
64 PsiBlast_CBE 67.9897% -59 - C1 -1XH9 8.9 KAPCA_BOVIN
39 PsiBlast_CBE 67.9199% -58 - C1 -3AGL 8.9 KAPCA_HUMAN
86 PsiBlast_CBE 67.8598% -60 - C1 -1STC 8.2 KAPCA_BOVIN
51 PsiBlast_CBE 67.8497% -58 - C1 -2JDT 5.8 KAPCA_BOVIN
46 PsiBlast_CBE 67.8097% -59 - C1 -4AXA 5.8 KAPCA_BOVIN
47 PsiBlast_CBE 67.7697% -57 - C1 -2UW7 5.4 KAPCA_BOVIN
50 PsiBlast_CBE 67.7597% -61 - C1 -2JDV 7.0 KAPCA_BOVIN
32 PsiBlast_CBE 67.7098% -56 - C1 -3L9M 6.0 KAPCA_HUMAN
49 PsiBlast_CBE 67.6897% -60 - C1 -2UVX 4.2 KAPCA_BOVIN
106 PsiBlast_CBE 67.6397% -56 - C1 -3FHI 8.0 KAPCA_MOUSE
72 PsiBlast_CBE 67.6397% -59 - C1 -3FJQ 8.5 KAPCA_MOUSE
67 PsiBlast_CBE 67.6397% -57 - C1 -4DIN 6.7 KAPCA_MOUSE
78 PsiBlast_CBE 67.5797% -57 - C1 -1ATP 7.6 KAPCA_MOUSE
45 PsiBlast_CBE 67.4297% -62 - C1 -3O7L 5.6 KAPCA_MOUSE
48 PsiBlast_CBE 67.4197% -57 - C1 -2UW4 3.0 KAPCA_BOVIN
36 PsiBlast_CBE 66.8998% -58 - C1 -1XH6 9.9 KAPCA_BOVIN
57 PsiBlast_CBE 66.8798% -57 - C1 -1YDR 5.0 KAPCA_BOVIN
74 PsiBlast_CBE 66.8097% -62 - C1 -1REJ 6.6 KAPCA_MOUSE
31 PsiBlast_CBE 66.4098% -58 - C1 -3L9M 6.3 KAPCA_HUMAN
84 PsiBlast_CBE 65.1298% -41 - C1 -3BWJ 3.7 KAPCA_BOVIN
61 PsiBlast_CBE 65.0298% -43 - C1 -2JDS 7.9 KAPCA_BOVIN
59 PsiBlast_CBE 64.7898% -39 - C1 -3ZO3 6.4 KAPCA_BOVIN
79 PsiBlast_CBE 64.3498% -41 - C1 -3KKV 8.1 KAPCA_BOVIN
60 PsiBlast_CBE 64.2698% -38 - C1 -3ZO1 3.5 KAPCA_BOVIN
98 PsiBlast_CBE 63.4697% -36 - C1 -2UW0 8.5 KAPCA_BOVIN
139 HHSearch 63.3944%-111 - C1 -4EJN 6.1 AKT1_HUMAN
119 HHSearch 63.3844%-105 * C1 *4GV1 7.5 AKT1_HUMAN
87 PsiBlast_CBE 63.3098% -41 - C1 -1Q8W 4.5 KAPCA_BOVIN
85 PsiBlast_CBE 63.2398% -40 - C1 -1XH4 2.4 KAPCA_BOVIN
90 PsiBlast_CBE 63.1497% -35 - C1 -2VO6 8.1 KAPCA_BOVIN
96 PsiBlast_CBE 62.6997% -39 - C1 -2UW5 7.0 KAPCA_BOVIN
124 HHSearch 62.5839% -93 - C1 -4DC2 3.2 KPCI_MOUSE
93 PsiBlast_CBE 62.5297% -35 - C1 -2VNW 3.0 KAPCA_BOVIN
88 PsiBlast_CBE 62.4797% -38 - C1 -4DG3 5.7 KAPCA_MOUSE
95 PsiBlast_CBE 62.4297% -39 - C1 -2UW6 2.8 KAPCA_BOVIN
100 PsiBlast_CBE 62.2797% -40 - C1 -2UVY 5.8 KAPCA_BOVIN
91 PsiBlast_CBE 62.1197% -37 - C1 -2VO3 7.6 KAPCA_BOVIN
92 PsiBlast_CBE 61.9997% -36 - C1 -2VNY 4.1 KAPCA_BOVIN
97 PsiBlast_CBE 61.9397% -39 - C1 -2UW3 4.2 KAPCA_BOVIN
99 PsiBlast_CBE 61.6597% -37 - C1 -2UVZ 4.9 KAPCA_BOVIN
94 PsiBlast_CBE 60.7997% -40 - C1 -2UW8 3.8 KAPCA_BOVIN
125 HHSearch 59.9043%-113 - C1 -2R5T 7.0 SGK1_HUMAN
144 HHSearch 57.7439%-105 - C1 -3A62 9.4 KS6B1_HUMAN
126 HHSearch 57.4642% -98 - C1 -3TXO 5.8
129 HHSearch 51.7340%-107 - C1 -3UBD 4.8 KS6A3_MOUSE
104 PsiBlast_CBE 49.2497% -11 - C1 -3AMB 3.9 KAPCA_HUMAN
105 PsiBlast_CBE 49.2297% -12 - C1 -3AMA 5.1 KAPCA_HUMAN
141 HHSearch 48.3035%-116 - C1 -4FG7 4.3 KCC1A_HUMAN