@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : MELK_HUMAN: (2013-07-23 )
MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKLKNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV

Atome Classification :

(72 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_A_3(4GV1)
AKT1_HUMAN
[Raw transfer]




ANP_A_2(4BL1)
MELK_HUMAN
[Raw transfer]




ATP_A_3(4FG9)
KCC1A_HUMAN
[Raw transfer]




ATP_A_3(4FG8)
KCC1A_HUMAN
[Raw transfer]




5HK_A_2(4FTR)
CHK1_HUMAN
[Raw transfer]




710_B_2(2HOG)
CHK1_HUMAN
[Raw transfer]




HKC_A_2(4FSR)
CHK1_HUMAN
[Raw transfer]




H9K_A_2(4FTK)
CHK1_HUMAN
[Raw transfer]




H0K_A_2(4FTL)
CHK1_HUMAN
[Raw transfer]




1HK_A_2(4FTM)
CHK1_HUMAN
[Raw transfer]




38R_A_2(3ZDU)
CDKL3_HUMAN
[Raw transfer]




ANP_A_5(3IGO)
?
[Raw transfer]




422_B_2(2HXL)
CHK1_HUMAN
[Raw transfer]




HK9_A_2(4FT0)
CHK1_HUMAN
[Raw transfer]




HK1_A_2(4FSM)
CHK1_HUMAN
[Raw transfer]




ATP_B_4(4FG9)
KCC1A_HUMAN
[Raw transfer]




5CP_A_5(3BHH)
KCC2B_HUMAN
[Raw transfer]




A58_A_2(4FSN)
CHK1_HUMAN
[Raw transfer]




HK3_A_2(4FSQ)
CHK1_HUMAN
[Raw transfer]




3HK_A_2(4FTO)
CHK1_HUMAN
[Raw transfer]




5CP_B_6(3BHH)
KCC2B_HUMAN
[Raw transfer]




IDZ_A_3(2C3L)
CHK1_HUMAN
[Raw transfer]




YVQ_A_2(2XEY)
CHK1_HUMAN
[Raw transfer]




ATP_B_4(4FG8)
KCC1A_HUMAN
[Raw transfer]




STU_A_5(2Y94)
AAPK1_RAT
[Raw transfer]




B6A_A_2(3UPX)
?
[Raw transfer]




M54_A_2(2R0U)
CHK1_HUMAN
[Raw transfer]




ATP_A_2(4FG7)
KCC1A_HUMAN
[Raw transfer]




YM7_A_2(2YM7)
CHK1_HUMAN
[Raw transfer]




373_B_2(2HXQ)
CHK1_HUMAN
[Raw transfer]




306_B_2(2HY0)
CHK1_HUMAN
[Raw transfer]




4UB_A_2(2XF0)
CHK1_HUMAN
[Raw transfer]




7CS_A_2(2QHM)
CHK1_HUMAN
[Raw transfer]




07U_A_2(3TXO)

[Raw transfer]




H8K_A_2(4FTJ)
CHK1_HUMAN
[Raw transfer]




H7K_A_2(4FTI)
CHK1_HUMAN
[Raw transfer]




S25_A_3(3TKI)
CHK1_HUMAN
[Raw transfer]




YM8_A_2(2YM8)
CHK1_HUMAN
[Raw transfer]




6HK_A_2(4FTT)
CHK1_HUMAN
[Raw transfer]




YM6_A_2(2YM6)
CHK1_HUMAN
[Raw transfer]




5BE_A_2(3NLB)
CHK1_HUMAN
[Raw transfer]




12C_A_4(2GDO)
CHK1_HUMAN
[Raw transfer]




BK3_A_2(3N51)
?
[Raw transfer]




07S_A_3(3TKH)
CHK1_HUMAN
[Raw transfer]




0XZ_A_2(4GV1)
AKT1_HUMAN
[Raw transfer]




GOL_A_9(3HZT)
?
[Raw transfer]




ANP_A_6(3HX4)
?
[Raw transfer]




582_A_2(2QHN)
CHK1_HUMAN
[Raw transfer]




ANP_A_7(3LIJ)
?
[Raw transfer]




ZYS_A_2(2WMS)
CHK1_HUMAN
[Raw transfer]




ANP_A_7(3COK)
PLK4_HUMAN
[Raw transfer]




X8D_A_2(2X8D)
CHK1_HUMAN
[Raw transfer]




3A3_A_2(2CGU)
CHK1_HUMAN
[Raw transfer]




H4K_A_2(4FT9)
CHK1_HUMAN
[Raw transfer]




X8I_A_2(2X8I)
CHK1_HUMAN
[Raw transfer]




J60_A_7(3HZT)
?
[Raw transfer]




3C3_A_2(2CGW)
CHK1_HUMAN
[Raw transfer]




1AO_A_5(4HYI)
CHK1_HUMAN
[Raw transfer]




C88_A_2(3V5P)
?
[Raw transfer]




3B3_A_2(2CGV)
CHK1_HUMAN
[Raw transfer]




YM3_A_2(2YM3)
CHK1_HUMAN
[Raw transfer]




TAK_A_2(3AQV)
AAPK2_HUMAN
[Raw transfer]




ZYU_A_2(2WMU)
CHK1_HUMAN
[Raw transfer]




4YM_A_2(2YM4)
CHK1_HUMAN
[Raw transfer]




ZYQ_A_2(2WMQ)
CHK1_HUMAN
[Raw transfer]




1AM_A_2(4HYH)
CHK1_HUMAN
[Raw transfer]




BK1_A_2(3I7B)
?
[Raw transfer]




BK7_A_2(3SX9)
?
[Raw transfer]




BK6_A_2(3T3U)
?
[Raw transfer]




3D3_A_2(2CGX)
CHK1_HUMAN
[Raw transfer]




DKI_A_2(2W4O)
KCC4_HUMAN
[Raw transfer]




YDI_A_3(2YDI)
CHK1_HUMAN
[Raw transfer]




EDO_A_5(2WEL)
KCC2D_HUMAN
[Raw transfer]




EDO_B_8(2JAM)
KCC1G_HUMAN
[Raw transfer]




EDO_A_3(3I7B)
?
[Raw transfer]




EDO_A_4(3T3U)
?
[Raw transfer]




EDO_A_4(2WEL)
KCC2D_HUMAN
[Raw transfer]




1 PsiBlast_PDB 96.0299%-129 - C1 -4BL1 6.7 MELK_HUMAN
50 PsiBlast_CBE 69.0934%-126 - C1 -3BHH 4.4 KCC2B_HUMAN
49 PsiBlast_CBE 68.9534%-126 - C1 -3BHH 5.0 KCC2B_HUMAN
66 PsiBlast_CBE 68.1534%-121 - C1 -2WEL 3.5 KCC2D_HUMAN
2 PsiBlast_PDB 66.9246%-113 - C1 -2Y94 8.0 AAPK1_RAT
34 PsiBlast_CBE 66.6636%-126 - C1 -3HX4 4.8 ?
29 PsiBlast_CBE 66.2734%-118 - C1 -4FG7 4.1 KCC1A_HUMAN
51 PsiBlast_CBE 65.1435%-130 - C1 -3LIJ 3.9 ?
123 HHSearch 64.8734%-125 - C1 -4GV1 5.8 AKT1_HUMAN
15 PsiBlast_PDB 64.3247%-117 - C1 -3AQV 5.8 AAPK2_HUMAN
43 PsiBlast_CBE 64.2136%-124 - C1 -3SX9 5.5 ?
32 PsiBlast_CBE 64.0336%-122 - C1 -3HZT 3.9 ?
39 PsiBlast_CBE 63.6236%-124 - C1 -3UPX 5.6 ?
41 PsiBlast_CBE 63.2936%-122 - C1 -3T3U 6.0 ?
36 PsiBlast_CBE 63.1036%-124 - C1 -3V5P 6.2 ?
45 PsiBlast_CBE 62.9736%-121 - C1 -3I7B 5.8 ?
27 PsiBlast_CBE 62.8334%-134 - C1 -4FG8 4.5 KCC1A_HUMAN
44 PsiBlast_CBE 62.2336%-119 - C1 -3N51 5.6 ?
55 PsiBlast_CBE 62.0834%-111 - C1 -3TKI 6.4 CHK1_HUMAN
79 PsiBlast_CBE 61.5334%-111 - C1 -4FSR 6.3 CHK1_HUMAN
77 PsiBlast_CBE 61.3834%-111 - C1 -4FT9 4.1 CHK1_HUMAN
76 PsiBlast_CBE 61.3134%-108 - C1 -4FTI 6.4 CHK1_HUMAN
28 PsiBlast_CBE 61.2634%-138 - C1 -4FG8 5.6 KCC1A_HUMAN
52 PsiBlast_CBE 61.1935%-130 - C1 -3COK 5.9 PLK4_HUMAN
97 PsiBlast_CBE 61.1234%-104 - C1 -2X8D 4.3 CHK1_HUMAN
65 PsiBlast_CBE 61.0934%-108 - C1 -4FSN 4.9 CHK1_HUMAN
25 PsiBlast_CBE 61.0334%-134 - C1 -4FG9 5.6 KCC1A_HUMAN
53 PsiBlast_CBE 60.7435%-119 - C1 -2W4O 4.7 KCC4_HUMAN
26 PsiBlast_CBE 60.5934%-132 - C1 -4FG9 5.6 KCC1A_HUMAN
61 PsiBlast_CBE 60.4734%-107 - C1 -2HY0 6.4 CHK1_HUMAN
64 PsiBlast_CBE 60.4234%-110 - C1 -2HOG 6.6 CHK1_HUMAN
80 PsiBlast_CBE 60.2334%-113 - C1 -4FSQ 7.1 CHK1_HUMAN
78 PsiBlast_CBE 60.1134%-110 - C1 -4FT0 5.8 CHK1_HUMAN
56 PsiBlast_CBE 60.0634%-112 - C1 -3TKH 4.9 CHK1_HUMAN
59 PsiBlast_CBE 59.9734%-106 - C1 -2QHM 3.7 CHK1_HUMAN
75 PsiBlast_CBE 59.9334%-113 - C1 -4FTJ 4.6 CHK1_HUMAN
84 PsiBlast_CBE 59.7735%-113 - C1 -3IGO 5.8 ?
58 PsiBlast_CBE 59.5334%-111 - C1 -2QHN 3.2 CHK1_HUMAN
74 PsiBlast_CBE 59.5134%-115 - C1 -4FTK 6.1 CHK1_HUMAN
69 PsiBlast_CBE 59.5134%-110 - C1 -4FTT 6.2 CHK1_HUMAN
87 PsiBlast_CBE 59.4634%-108 - C1 -3NLB 5.9 CHK1_HUMAN
95 PsiBlast_CBE 59.2934%-115 - C1 -2XEY 4.8 CHK1_HUMAN
70 PsiBlast_CBE 59.0734%-113 - C1 -4FTR 6.1 CHK1_HUMAN
93 PsiBlast_CBE 59.0434%-104 - C1 -2YDI 3.5 CHK1_HUMAN
85 PsiBlast_CBE 58.9334%-100 - C1 -4HYI 4.7 CHK1_HUMAN
90 PsiBlast_CBE 58.9234%-112 - C1 -2YM6 4.6 CHK1_HUMAN
57 PsiBlast_CBE 58.8834%-108 - C1 -2R0U 5.5 CHK1_HUMAN
81 PsiBlast_CBE 58.8434%-113 - C1 -4FSM 5.5 CHK1_HUMAN
62 PsiBlast_CBE 58.8334%-102 - C1 -2HXQ 4.7 CHK1_HUMAN
106 PsiBlast_CBE 58.5834%-109 - C1 -2C3L 3.8 CHK1_HUMAN
72 PsiBlast_CBE 58.5434%-111 - C1 -4FTM 6.2 CHK1_HUMAN
86 PsiBlast_CBE 58.5234%-107 - C1 -4HYH 7.3 CHK1_HUMAN
63 PsiBlast_CBE 58.4634%-103 - C1 -2HXL 5.2 CHK1_HUMAN
73 PsiBlast_CBE 58.4134%-113 - C1 -4FTL 7.3 CHK1_HUMAN
30 PsiBlast_CBE 58.3535%-125 - C1 -2JAM 2.0 KCC1G_HUMAN
104 PsiBlast_CBE 58.1434%-106 - C1 -2CGV 4.1 CHK1_HUMAN
103 PsiBlast_CBE 58.1434%-107 - C1 -2CGW 3.7 CHK1_HUMAN
96 PsiBlast_CBE 58.1134%-110 - C1 -2X8I 4.1 CHK1_HUMAN
105 PsiBlast_CBE 58.0034%-104 - C1 -2CGU 4.6 CHK1_HUMAN
71 PsiBlast_CBE 57.9334%-117 - C1 -4FTO 6.6 CHK1_HUMAN
91 PsiBlast_CBE 57.8334%-114 - C1 -2YM4 4.3 CHK1_HUMAN
101 PsiBlast_CBE 57.7434%-106 - C1 -2GDO 5.0 CHK1_HUMAN
88 PsiBlast_CBE 57.5134%-114 - C1 -2YM8 5.4 CHK1_HUMAN
102 PsiBlast_CBE 57.4034%-104 - C1 -2CGX 4.2 CHK1_HUMAN
94 PsiBlast_CBE 57.1734%-113 - C1 -2XF0 4.8 CHK1_HUMAN
99 PsiBlast_CBE 57.1434%-118 - C1 -2WMS 3.3 CHK1_HUMAN
140 HHSearch 57.1132%-108 - C1 -3TXO 6.1
92 PsiBlast_CBE 56.8734%-113 - C1 -2YM3 4.6 CHK1_HUMAN
98 PsiBlast_CBE 56.5834%-113 - C1 -2WMU 4.1 CHK1_HUMAN
89 PsiBlast_CBE 56.2134%-114 - C1 -2YM7 5.1 CHK1_HUMAN
133 HHSearch 56.1630%-106 - C1 -3ZDU 6.0 CDKL3_HUMAN
100 PsiBlast_CBE 55.9634%-106 - C1 -2WMQ 2.7 CHK1_HUMAN