@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : MK01_HUMAN: (2013-07-23 )
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Atome Classification :

(78 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

82A_A_3(2OJJ)
MK01_HUMAN
[Raw transfer]




ADP_A_3(2F9G)
FUS3_YEAST
[Raw transfer]




E63_A_2(4FV8)
MK01_HUMAN
[Raw transfer]




ADP_A_4(2B9H)
FUS3_YEAST
[Raw transfer]




Z48_A_6(3I5Z)
MK01_HUMAN
[Raw transfer]




19A_C_3(2OJG)
MK01_HUMAN
[Raw transfer]




ADP_A_4(2B9I)
FUS3_YEAST
[Raw transfer]




ANP_A_3(4FMQ)
MK01_HUMAN
[Raw transfer]




E86_A_5(3I60)
MK01_HUMAN
[Raw transfer]




ANP_A_5(4IC7)
MK07_HUMAN
[Raw transfer]




ADP_A_3(2B9F)
FUS3_YEAST
[Raw transfer]




E57_A_2(4FV6)
MK01_HUMAN
[Raw transfer]




33A_A_3(2OJI)
MK01_HUMAN
[Raw transfer]




G17_A_2(4I5H)
?
[Raw transfer]




EK5_A_2(4FV2)
MK01_HUMAN
[Raw transfer]




ANP_D_6(4H3P)
MK01_HUMAN
[Raw transfer]




ANP_A_5(4H3P)
MK01_HUMAN
[Raw transfer]




EK4_A_2(4FV1)
MK01_HUMAN
[Raw transfer]




ANP_A_3(4H3Q)
MK01_HUMAN
[Raw transfer]




EK9_A_2(4FV5)
MK01_HUMAN
[Raw transfer]




ANP_A_3(3TEI)
MK01_HUMAN
[Raw transfer]




ADP_A_4(2B9J)
FUS3_YEAST
[Raw transfer]




EK7_A_2(4FV4)
MK01_HUMAN
[Raw transfer]




E71_A_2(4FV9)
MK01_HUMAN
[Raw transfer]




ANP_D_6(4IC7)
MK07_HUMAN
[Raw transfer]




ATP_A_3(4GT3)
MK01_RAT
[Raw transfer]




E94_A_2(4FV7)
MK01_HUMAN
[Raw transfer]




ANP_C_3(1J1B)
GSK3B_HUMAN
[Raw transfer]




F29_B_2(1WZY)
MK01_HUMAN
[Raw transfer]




S91_A_3(2Z7L)
MK01_RAT
[Raw transfer]




OLO_C_3(4ERK)
MK01_RAT
[Raw transfer]




EK6_A_2(4FV3)
MK01_HUMAN
[Raw transfer]




FRZ_B_2(1TVO)
MK01_HUMAN
[Raw transfer]




E28_A_2(4G6O)
MK01_HUMAN
[Raw transfer]




ATP_A_3(1GOL)
MK01_RAT
[Raw transfer]




GOL_A_3(3N9X)
?
[Raw transfer]




EK3_A_2(4FV0)
MK01_HUMAN
[Raw transfer]




LM4_A_4(4F9W)
?
[Raw transfer]




6PB_A_2(3QYW)
MK01_RAT
[Raw transfer]




LM3_A_4(4F9Y)
?
[Raw transfer]




E75_A_2(4FUX)
MK01_HUMAN
[Raw transfer]




JBI_A_2(3TTJ)
MK10_HUMAN
[Raw transfer]




533_A_2(3FMH)
MK14_HUMAN
[Raw transfer]




FKL_A_2(3FKL)
MK14_HUMAN
[Raw transfer]




I47_A_2(3HL7)
MK14_HUMAN
[Raw transfer]




R4L_A_2(4B99)
MK07_HUMAN
[Raw transfer]




RO6_A_2(3FSK)
MK14_HUMAN
[Raw transfer]




GK4_A_2(2ZB1)
MK14_HUMAN
[Raw transfer]




ADP_A_2(4GVA)
MK01_RAT
[Raw transfer]




FLZ_A_2(3FLZ)
MK14_HUMAN
[Raw transfer]




L9G_A_2(3KF7)
MK14_HUMAN
[Raw transfer]




FPH_A_2(1OZ1)
MK14_HUMAN
[Raw transfer]




I2O_A_2(3RIN)
MK14_HUMAN
[Raw transfer]




FMJ_A_2(3FMJ)
MK14_HUMAN
[Raw transfer]




GOL_A_3(4GVA)
MK01_RAT
[Raw transfer]




FLY_A_2(3FLY)
MK14_HUMAN
[Raw transfer]




EK0_A_2(4G6N)
MK01_HUMAN
[Raw transfer]




SB0_A_3(4FA2)
?
[Raw transfer]




FLW_A_2(3FLW)
MK14_HUMAN
[Raw transfer]




530_A_2(3FMN)
MK14_HUMAN
[Raw transfer]




PQB_A_2(2GFS)
MK14_HUMAN
[Raw transfer]




FLS_A_2(3FLS)
MK14_HUMAN
[Raw transfer]




FSS_A_2(3FSF)
MK14_HUMAN
[Raw transfer]




891_A_2(3FLQ)
MK14_HUMAN
[Raw transfer]




P36_A_2(3HP2)
MK14_HUMAN
[Raw transfer]




GK3_A_2(2ZB0)
MK14_HUMAN
[Raw transfer]




FML_A_2(3FML)
MK14_HUMAN
[Raw transfer]




GK1_A_3(2ZAZ)
MK14_HUMAN
[Raw transfer]




29A_A_2(3ROC)
MK14_HUMAN
[Raw transfer]




JZJ_A_2(3K3I)
MK14_HUMAN
[Raw transfer]




FL4_A_2(3FL4)
MK14_HUMAN
[Raw transfer]




EK2_A_2(4FUY)
MK01_HUMAN
[Raw transfer]




52P_A_2(3HP5)
MK14_HUMAN
[Raw transfer]




I45_A_2(3HLL)
MK14_HUMAN
[Raw transfer]




SB4_B_2(3ERK)
MK01_RAT
[Raw transfer]




FKN_A_2(3FKN)
MK14_HUMAN
[Raw transfer]




PGE_A_9(4GSB)
MK01_RAT
[Raw transfer]




EDO_A_4(4FA2)
?
[Raw transfer]




PEG_A_7(4F9Y)
?
[Raw transfer]




SB2_C_3(1PME)
MK01_HUMAN
[Raw transfer]




EDO_A_5(4FUY)
MK01_HUMAN
[Raw transfer]




9 PsiBlast_CBE 96.67100%-139 - C1 -3I60 8.9 MK01_HUMAN
25 PsiBlast_CBE 96.4299%-124 - C1 -1GOL 2.3 MK01_RAT
8 PsiBlast_CBE 95.99100%-136 - C1 -4FV6 9.0 MK01_HUMAN
14 PsiBlast_CBE 95.5599%-131 - C1 -4H3P 5.3 MK01_HUMAN
19 PsiBlast_CBE 95.4699%-128 - C1 -4ERK 4.5 MK01_RAT
11 PsiBlast_CBE 95.37100%-131 - C1 -2OJJ 8.2 MK01_HUMAN
10 PsiBlast_CBE 95.30100%-138 - C1 -3I5Z 8.7 MK01_HUMAN
7 PsiBlast_PDB 94.8099%-129 - C1 -4H3P 5.5 MK01_HUMAN
12 PsiBlast_CBE 94.57100%-129 - C1 -2OJI 7.2 MK01_HUMAN
21 PsiBlast_CBE 94.5099%-125 - C1 -3ERK 6.1 MK01_RAT
6 PsiBlast_PDB 94.1599%-125 - C1 -3TEI 4.8 MK01_HUMAN
3 PsiBlast_PDB 94.15100%-120 - C1 -1WZY 4.5 MK01_HUMAN
5 PsiBlast_PDB 93.97100%-127 - C1 -1TVO 6.3 MK01_HUMAN
13 PsiBlast_CBE 93.90100%-127 - C1 -2OJG 6.1 MK01_HUMAN
18 PsiBlast_CBE 93.4399%-134 - C1 -2Z7L 5.9 MK01_RAT
2 PsiBlast_PDB 93.22100%-129 - C1 -4FMQ 7.2 MK01_HUMAN
24 PsiBlast_CBE 92.4298%-124 - C1 -4H3Q 6.6 MK01_HUMAN
28 PsiBlast_CBE 91.3398%-130 - C1 -4I5H 8.5 ?
63 PsiBlast_CBE 78.1250%-125 - C1 -4IC7 5.3 MK07_HUMAN
62 PsiBlast_CBE 77.8550%-123 - C1 -4IC7 5.6 MK07_HUMAN
111 HHSearch 76.6651%-124 - C1 -2B9H 5.4 FUS3_YEAST
61 PsiBlast_CBE 76.4950%-129 - C1 -4B99 7.5 MK07_HUMAN
79 PsiBlast_CBE 76.4748%-121 - C1 -3FKL 8.1 MK14_HUMAN
52 PsiBlast_CBE 76.4750%-125 - C1 -2B9F 5.5 FUS3_YEAST
83 PsiBlast_CBE 76.4448%-128 - C1 -4F9Y 5.6 ?
91 PsiBlast_CBE 76.2948%-128 - C1 -3KF7 5.9 MK14_HUMAN
65 PsiBlast_CBE 76.0247%-126 - C1 -3K3I 7.3 MK14_HUMAN
82 PsiBlast_CBE 75.9248%-127 - C1 -4FA2 6.8 ?
84 PsiBlast_CBE 75.8448%-127 - C1 -4F9W 5.5 ?
58 PsiBlast_CBE 75.6950%-123 - C1 -2B9I 5.3 FUS3_YEAST
100 HHSearch 75.5841%-126 - C1 -3N9X 3.5 ?
81 PsiBlast_CBE 75.4548%-127 - C1 -1OZ1 4.2 MK14_HUMAN
57 PsiBlast_CBE 75.2950%-124 - C1 -2B9J 5.3 FUS3_YEAST
95 PsiBlast_CBE 75.2548%-128 * C1 *3HL7 5.7 MK14_HUMAN
94 PsiBlast_CBE 75.1848%-127 - C1 -3HLL 6.2 MK14_HUMAN
71 PsiBlast_CBE 74.9948%-123 - C1 -3FMH 5.6 MK14_HUMAN
96 PsiBlast_CBE 74.9648%-126 - C1 -2ZB1 4.8 MK14_HUMAN
73 PsiBlast_CBE 74.9448%-123 - C1 -3FLY 4.9 MK14_HUMAN
72 PsiBlast_CBE 74.9448%-125 - C1 -3FLZ 5.3 MK14_HUMAN
98 PsiBlast_CBE 74.9148%-126 - C1 -2ZAZ 5.4 MK14_HUMAN
60 PsiBlast_CBE 74.8750%-122 - C1 -2F9G 4.3 FUS3_YEAST
69 PsiBlast_CBE 74.7548%-125 - C1 -3FML 5.0 MK14_HUMAN
97 PsiBlast_CBE 74.7048%-126 - C1 -2ZB0 7.8 MK14_HUMAN
66 PsiBlast_CBE 74.5848%-126 - C1 -3FSK 5.5 MK14_HUMAN
93 PsiBlast_CBE 74.5748%-126 - C1 -3HP2 5.9 MK14_HUMAN
88 PsiBlast_CBE 74.5348%-126 - C1 -3ROC 6.2 MK14_HUMAN
77 PsiBlast_CBE 74.4748%-130 - C1 -3FL4 4.3 MK14_HUMAN
107 HHSearch 74.3642%-125 - C1 -3TTJ 7.7 MK10_HUMAN
92 PsiBlast_CBE 74.2948%-125 - C1 -3HP5 5.6 MK14_HUMAN
89 PsiBlast_CBE 74.1048%-126 - C1 -3RIN 6.6 MK14_HUMAN
75 PsiBlast_CBE 74.0548%-125 - C1 -3FLS 5.3 MK14_HUMAN
74 PsiBlast_CBE 73.9948%-124 - C1 -3FLW 5.4 MK14_HUMAN
70 PsiBlast_CBE 73.9348%-128 - C1 -3FMJ 4.8 MK14_HUMAN
68 PsiBlast_CBE 73.8548%-126 - C1 -3FMN 5.7 MK14_HUMAN
76 PsiBlast_CBE 73.7048%-123 - C1 -3FLQ 5.8 MK14_HUMAN
67 PsiBlast_CBE 73.6748%-127 - C1 -3FSF 5.4 MK14_HUMAN
78 PsiBlast_CBE 73.6048%-124 - C1 -3FKN 5.4 MK14_HUMAN
104 HHSearch 72.9448%-126 - C1 -2FST - MK14_HUMAN
80 PsiBlast_CBE 72.9448%-123 - C1 -2GFS 4.4 MK14_HUMAN
50 PsiBlast_CBE 71.0099% -63 - C1 -4FV0 5.8 MK01_HUMAN
51 PsiBlast_CBE 70.7799% -67 - C1 -4FUY 6.8 MK01_HUMAN
39 PsiBlast_CBE 69.7799% -73 - C1 -4FV8 8.2 MK01_HUMAN
41 PsiBlast_CBE 69.1699% -74 - C1 -4FV4 7.2 MK01_HUMAN
38 PsiBlast_CBE 69.1499% -71 - C1 -4FV9 8.0 MK01_HUMAN
40 PsiBlast_CBE 68.5999% -72 - C1 -4FV5 8.7 MK01_HUMAN
34 PsiBlast_CBE 68.4099% -66 - C1 -4GT3 4.2 MK01_RAT
37 PsiBlast_CBE 68.0499% -71 - C1 -4G6N 5.5 MK01_HUMAN
43 PsiBlast_CBE 67.8599% -69 - C1 -4FV2 6.7 MK01_HUMAN
42 PsiBlast_CBE 67.6899% -69 - C1 -4FV3 8.8 MK01_HUMAN
44 PsiBlast_CBE 67.3699% -70 - C1 -4FV1 8.6 MK01_HUMAN
36 PsiBlast_CBE 67.2799% -70 - C1 -3QYW 5.6 MK01_RAT
45 PsiBlast_CBE 67.1399% -68 - C1 -4FUX 6.0 MK01_HUMAN
33 PsiBlast_CBE 67.0699% -66 - C1 -4GVA 4.2 MK01_RAT
49 PsiBlast_CBE 66.6998% -76 - C1 -1PME 0.9 MK01_HUMAN
48 PsiBlast_CBE 66.0799% -59 - C1 -4FV7 9.8 MK01_HUMAN
47 PsiBlast_CBE 62.4699% -59 - C1 -4G6O 6.9 MK01_HUMAN
46 PsiBlast_CBE 53.8499% -29 - C1 -4GSB 2.0 MK01_RAT
114 HHSearch 52.8834%-119 - C1 -1J1B 4.3 GSK3B_HUMAN