@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : MK12_HUMAN: (2015-06-17 )
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL

Atome Classification :

(44 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

P5K_A_3(3P5K)
MK14_MOUSE
[Raw transfer]




P7B_A_2(3P7B)
MK14_MOUSE
[Raw transfer]




P7A_A_3(3P7A)
MK14_MOUSE
[Raw transfer]




LI2_A_2(1WBS)
MK14_HUMAN
[Raw transfer]




AA0_A_2(4AA0)
MK14_HUMAN
[Raw transfer]




I2O_A_2(3RIN)
MK14_HUMAN
[Raw transfer]




L10_A_2(1W82)
MK14_HUMAN
[Raw transfer]




BMU_A_2(1KV1)
MK14_HUMAN
[Raw transfer]




GK5_A_3(3D7Z)
MK14_HUMAN
[Raw transfer]




09J_A_2(3U8W)
MK14_HUMAN
[Raw transfer]




LI3_A_2(1WBV)
MK14_HUMAN
[Raw transfer]




F4C_A_2(3K3J)
MK14_HUMAN
[Raw transfer]




P7C_A_3(3P7C)
MK14_MOUSE
[Raw transfer]




JZJ_A_2(3K3I)
MK14_HUMAN
[Raw transfer]




P66_A_2(3ITZ)
MK14_HUMAN
[Raw transfer]




FKL_A_2(3FKL)
MK14_HUMAN
[Raw transfer]




LHJ_A_2(3LHJ)
MK14_HUMAN
[Raw transfer]




0OP_A_3(4EH8)
MK14_HUMAN
[Raw transfer]




P78_A_3(3P78)
MK14_MOUSE
[Raw transfer]




QC0_A_2(4AA4)
MK14_HUMAN
[Raw transfer]




ANP_A_7(1CM8)
MK12_HUMAN
[Raw transfer]




P37_A_2(3GFE)
MK14_HUMAN
[Raw transfer]




ANP_A_7(1CM8)
MK12_HUMAN
[Raw transfer]




GK4_A_2(2ZB1)
MK14_HUMAN
[Raw transfer]




0RX_A_2(4EYM)
MK13_HUMAN
[Raw transfer]




GK1_A_3(2ZAZ)
MK14_HUMAN
[Raw transfer]




FLZ_A_2(3FLZ)
MK14_HUMAN
[Raw transfer]




LM4_A_4(4F9W)
MK14_HUMAN
[Raw transfer]




RO6_A_2(3FSK)
MK14_HUMAN
[Raw transfer]




1N1_A_3(3OHT)
?
[Raw transfer]




LM3_A_4(4F9Y)
MK14_HUMAN
[Raw transfer]




L12_A_2(1W84)
MK14_HUMAN
[Raw transfer]




1N1_B_5(3OHT)
?
[Raw transfer]




SB0_A_3(4FA2)
MK14_HUMAN
[Raw transfer]




BOG_X_3(2FST)
MK14_HUMAN
[Raw transfer]




3IP_A_2(1W7H)
MK14_HUMAN
[Raw transfer]




FSS_A_2(3FSF)
MK14_HUMAN
[Raw transfer]




2A8_A_2(3ZYA)
MK14_HUMAN
[Raw transfer]




0SJ_A_2(4EHV)
MK14_HUMAN
[Raw transfer]




2CH_A_2(1WBO)
MK14_HUMAN
[Raw transfer]




FLY_A_2(3FLY)
MK14_HUMAN
[Raw transfer]




FLW_A_2(3FLW)
MK14_HUMAN
[Raw transfer]




R4L_A_2(4B99)
MK07_HUMAN
[Raw transfer]




EDO_A_4(4FA2)
MK14_HUMAN
[Raw transfer]




JBI_A_2(3TTJ)
MK10_HUMAN
[Raw transfer]




I39_A_2(3HRB)
MK14_HUMAN
[Raw transfer]




117 HHSearch 95.32100%-125 - C1 -1CM8 5.3 MK12_HUMAN
1 PsiBlast_PDB 95.0799%-125 - C1 -1CM8 5.3 MK12_HUMAN
86 PsiBlast_CBE 86.0963%-116 - C1 -3FSK 6.6 MK14_HUMAN
20 PsiBlast_PDB 86.0263%-113 - C1 -3FLZ 7.1 MK14_HUMAN
18 PsiBlast_PDB 85.8863%-116 - C1 -3FLW 7.4 MK14_HUMAN
87 PsiBlast_CBE 85.5463%-117 - C1 -3FSF 5.5 MK14_HUMAN
81 PsiBlast_CBE 85.3663%-113 - C1 -3HRB 7.1 MK14_HUMAN
60 PsiBlast_CBE 85.3263%-116 - C1 -2ZAZ 5.2 MK14_HUMAN
6 PsiBlast_PDB 85.2762%-116 - C1 -4F9Y 7.0 MK14_HUMAN
66 PsiBlast_CBE 85.2463%-121 - C1 -1WBO 3.6 MK14_HUMAN
75 PsiBlast_CBE 85.0463%-117 - C1 -3K3I 9.1 MK14_HUMAN
70 PsiBlast_CBE 85.0063%-115 - C1 -1W82 8.7 MK14_HUMAN
68 PsiBlast_CBE 84.9863%-116 - C1 -1W84 5.8 MK14_HUMAN
65 PsiBlast_CBE 84.8863%-116 - C1 -1WBS 10.9 MK14_HUMAN
19 PsiBlast_PDB 84.8463%-112 - C1 -3FLY 7.2 MK14_HUMAN
58 PsiBlast_CBE 84.7963%-117 - C1 -2ZB1 8.2 MK14_HUMAN
77 PsiBlast_CBE 84.7263%-116 - C1 -4AA4 8.1 MK14_HUMAN
71 PsiBlast_CBE 84.7163%-117 - C1 -1W7H 4.8 MK14_HUMAN
45 PsiBlast_CBE 84.6763%-122 - C1 -3P78 2.6 MK14_MOUSE
5 PsiBlast_PDB 84.5962%-117 - C1 -4F9W 7.3 MK14_HUMAN
51 PsiBlast_CBE 84.5763%-115 - C1 -3RIN 9.1 MK14_HUMAN
46 PsiBlast_CBE 84.5563%-122 - C1 -3P5K 9.4 MK14_MOUSE
26 PsiBlast_CBE 84.5063%-114 - C1 -3U8W 8.8 MK14_HUMAN
7 PsiBlast_PDB 84.5062%-115 - C1 -4FA2 8.1 MK14_HUMAN
13 PsiBlast_PDB 84.2163%-112 - C1 -3FKL 9.2 MK14_HUMAN
78 PsiBlast_CBE 84.2063%-117 - C1 -4AA0 10.7 MK14_HUMAN
63 PsiBlast_CBE 84.1663%-116 - C1 -1WBV 8.1 MK14_HUMAN
41 PsiBlast_CBE 84.1063%-122 - C1 -3P7C 9.4 MK14_MOUSE
8 PsiBlast_PDB 83.6063%-117 - C1 -3D7Z 8.3 MK14_HUMAN
42 PsiBlast_CBE 83.5563%-117 - C1 -3P7B 9.8 MK14_MOUSE
27 PsiBlast_CBE 83.4463%-116 - C1 -3LHJ 10.1 MK14_HUMAN
25 PsiBlast_CBE 83.0063%-118 - C1 -3ZYA 8.7 MK14_HUMAN
43 PsiBlast_CBE 82.9763%-115 - C1 -3P7A 8.4 MK14_MOUSE
29 PsiBlast_CBE 82.9763%-113 - C1 -3GFE 6.7 MK14_HUMAN
73 PsiBlast_CBE 82.8763%-113 - C1 -1KV1 6.9 MK14_HUMAN
94 PsiBlast_CBE 82.7963%-116 - C1 -4EHV 6.1 MK14_HUMAN
10 PsiBlast_PDB 82.7863%-115 - C1 -3K3J 9.0 MK14_HUMAN
4 PsiBlast_PDB 82.1467%-116 - C1 -4EYM 7.4 MK13_HUMAN
28 PsiBlast_CBE 82.0563%-115 - C1 -3ITZ 7.8 MK14_HUMAN
118 HHSearch 81.2262%-120 * C1 *2FST 3.9 MK14_HUMAN
2 PsiBlast_PDB 75.7263%-114 - C1 -3OHT 6.8 ?
21 PsiBlast_CBE 75.3463%-112 - C1 -3OHT 7.6 ?
126 HHSearch 73.9848%-110 - C1 -3TTJ 8.9 MK10_HUMAN
119 HHSearch 68.4039%-111 - C1 -4B99 7.3 MK07_HUMAN