@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : MK13_HUMAN: (2015-06-17 )
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL

Atome Classification :

(32 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

0RX_A_2(4EYM)
MK13_HUMAN
[Raw transfer]




FKL_A_2(3FKL)
MK14_HUMAN
[Raw transfer]




09J_A_2(3U8W)
MK14_HUMAN
[Raw transfer]




LI4_A_2(1WBW)
MK14_HUMAN
[Raw transfer]




ANP_A_7(1CM8)
MK12_HUMAN
[Raw transfer]




GK1_A_3(2ZAZ)
MK14_HUMAN
[Raw transfer]




FMJ_A_2(3FMJ)
MK14_HUMAN
[Raw transfer]




LM4_A_4(4F9W)
MK14_HUMAN
[Raw transfer]




FLZ_A_2(3FLZ)
MK14_HUMAN
[Raw transfer]




GK4_A_2(2ZB1)
MK14_HUMAN
[Raw transfer]




LM3_A_4(4F9Y)
MK14_HUMAN
[Raw transfer]




1N1_A_3(3OHT)
?
[Raw transfer]




437_A_2(3NNV)
MK14_HUMAN
[Raw transfer]




GK3_A_2(2ZB0)
MK14_HUMAN
[Raw transfer]




P5K_A_3(3P5K)
MK14_MOUSE
[Raw transfer]




P7B_A_2(3P7B)
MK14_MOUSE
[Raw transfer]




SB0_A_3(4FA2)
MK14_HUMAN
[Raw transfer]




P37_A_2(3GFE)
MK14_HUMAN
[Raw transfer]




FLS_A_2(3FLS)
MK14_HUMAN
[Raw transfer]




FLW_A_2(3FLW)
MK14_HUMAN
[Raw transfer]




MSQ_B_2(1DI9)
MK14_HUMAN
[Raw transfer]




P78_A_3(3P78)
MK14_MOUSE
[Raw transfer]




P79_A_3(3P79)
MK14_MOUSE
[Raw transfer]




P7A_A_3(3P7A)
MK14_MOUSE
[Raw transfer]




FLY_A_2(3FLY)
MK14_HUMAN
[Raw transfer]




L10_A_2(1W82)
MK14_HUMAN
[Raw transfer]




B11_C_3(1ZZ2)
MK14_HUMAN
[Raw transfer]




BMU_A_2(1KV1)
MK14_HUMAN
[Raw transfer]




LI3_A_2(1WBV)
MK14_HUMAN
[Raw transfer]




EDD_A_2(3NNW)
MK14_HUMAN
[Raw transfer]




R4L_A_2(4B99)
MK07_HUMAN
[Raw transfer]




JBI_A_2(3TTJ)
MK10_HUMAN
[Raw transfer]




FL4_A_2(3FL4)
MK14_HUMAN
[Raw transfer]




P7C_A_3(3P7C)
MK14_MOUSE
[Raw transfer]




2CH_A_2(1WBO)
MK14_HUMAN
[Raw transfer]




EDB_A_2(3NNU)
MK14_HUMAN
[Raw transfer]




PQB_A_2(2GFS)
MK14_HUMAN
[Raw transfer]




EDO_A_4(4FA2)
MK14_HUMAN
[Raw transfer]




BOG_X_3(2FST)
MK14_HUMAN
[Raw transfer]




1 PsiBlast_PDB 94.75100%-116 - C1 -4EYM 7.4 MK13_HUMAN
3 PsiBlast_PDB 86.5566%-128 - C1 -1CM8 5.5 MK12_HUMAN
15 PsiBlast_PDB 84.4961%-114 - C1 -3FLW 7.4 MK14_HUMAN
17 PsiBlast_PDB 84.3261%-113 - C1 -3FLZ 7.1 MK14_HUMAN
80 PsiBlast_CBE 84.3161%-116 - C1 -2ZB1 8.2 MK14_HUMAN
82 PsiBlast_CBE 84.2161%-116 - C1 -2ZAZ 5.1 MK14_HUMAN
96 PsiBlast_CBE 84.1461%-114 - C1 -1DI9 5.6 MK14_HUMAN
88 PsiBlast_CBE 84.0861%-120 - C1 -1WBO 3.6 MK14_HUMAN
47 PsiBlast_CBE 84.0161%-116 - C1 -3NNW 9.9 MK14_HUMAN
84 PsiBlast_CBE 83.9761%-115 - C1 -1WBW 6.4 MK14_HUMAN
85 PsiBlast_CBE 83.9661%-114 - C1 -1WBV 8.2 MK14_HUMAN
81 PsiBlast_CBE 83.9161%-116 - C1 -2ZB0 7.0 MK14_HUMAN
54 PsiBlast_CBE 83.8562%-114 - C1 -3U8W 8.8 MK14_HUMAN
14 PsiBlast_PDB 83.8361%-115 - C1 -3FLS 7.1 MK14_HUMAN
92 PsiBlast_CBE 83.8161%-113 - C1 -1W82 8.7 MK14_HUMAN
49 PsiBlast_CBE 83.8161%-116 - C1 -3NNU 9.5 MK14_HUMAN
19 PsiBlast_PDB 83.8161%-116 - C1 -3FMJ 5.8 MK14_HUMAN
10 PsiBlast_PDB 83.5061%-111 - C1 -3FKL 9.2 MK14_HUMAN
7 PsiBlast_PDB 83.5061%-115 - C1 -4F9Y 7.0 MK14_HUMAN
28 PsiBlast_CBE 83.3561%-119 - C1 -3P78 2.6 MK14_MOUSE
6 PsiBlast_PDB 83.0261%-114 - C1 -4F9W 7.3 MK14_HUMAN
8 PsiBlast_PDB 82.9361%-113 - C1 -4FA2 8.1 MK14_HUMAN
26 PsiBlast_CBE 82.8061%-116 - C1 -3P7A 8.4 MK14_MOUSE
9 PsiBlast_PDB 82.5561%-114 - C1 -2GFS 4.2 MK14_HUMAN
25 PsiBlast_CBE 82.3161%-116 - C1 -3P7B 9.9 MK14_MOUSE
29 PsiBlast_CBE 81.9861%-120 - C1 -3P5K 9.4 MK14_MOUSE
24 PsiBlast_CBE 81.9761%-119 - C1 -3P7C 9.4 MK14_MOUSE
27 PsiBlast_CBE 81.9461%-120 - C1 -3P79 9.8 MK14_MOUSE
126 HHSearch 81.8048%-113 - C1 -3TTJ 8.9 MK10_HUMAN
118 HHSearch 80.8761%-116 * C1 *2FST 3.9 MK14_HUMAN
5 PsiBlast_PDB 77.1159%-114 - C1 -3OHT 7.0 ?
119 HHSearch 73.2943%-118 - C1 -4B99 7.2 MK07_HUMAN