@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PAK1_HUMAN: (2013-07-24 )
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH

Atome Classification :

(46 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_B_4(4FIE)
PAK4_HUMAN
[Raw transfer]




ANP_B_6(4FIF)
PAK4_HUMAN
[Raw transfer]




ANP_A_3(4FIE)
PAK4_HUMAN
[Raw transfer]




X4Z_A_4(2X4Z)

[Raw transfer]




ANP_A_3(4FIE)
PAK4_HUMAN
[Raw transfer]




ANP_A_5(4FIF)
PAK4_HUMAN
[Raw transfer]




IE8_A_4(4BID)
?
[Raw transfer]




ANP_A_3(4FIG)
?
[Raw transfer]




N53_A_2(4APP)

[Raw transfer]




ANP_B_6(4FIG)
?
[Raw transfer]




IE8_B_6(4BID)
?
[Raw transfer]




ADP_A_2(3A7J)
STK24_HUMAN
[Raw transfer]




IE4_A_3(4BIC)
?
[Raw transfer]




GVD_B_11(3GGF)
MST4_HUMAN
[Raw transfer]




DKI_B_3(4FZF)
?
[Raw transfer]




GOL_A_2(2X4Z)

[Raw transfer]




GOL_A_3(4APP)

[Raw transfer]




IE6_B_6(4BIE)
?
[Raw transfer]




GVD_A_7(3GGF)
MST4_HUMAN
[Raw transfer]




IE4_A_4(4BIC)
?
[Raw transfer]




ANP_B_7(3DAK)
OXSR1_HUMAN
[Raw transfer]




FLL_A_2(3FXZ)
?
[Raw transfer]




FLL_A_2(3FXZ)
?
[Raw transfer]




STU_A_3(2CLQ)
M3K5_HUMAN
[Raw transfer]




IE6_A_4(4BIE)
?
[Raw transfer]




23D_A_2(2CDZ)
PAK4_HUMAN
[Raw transfer]




ATP_A_2(3Q53)
PAK1_HUMAN
[Raw transfer]




IEO_B_8(4BIB)
?
[Raw transfer]




ANP_A_4(3Q4Z)
PAK1_HUMAN
[Raw transfer]




ANP_A_5(3DAK)
OXSR1_HUMAN
[Raw transfer]




ANP_C_9(3DAK)
OXSR1_HUMAN
[Raw transfer]




STU_B_5(4BF2)
?
[Raw transfer]




GOL_B_3(4FZA)
MST4_HUMAN
[Raw transfer]




STU_A_3(4BF2)
?
[Raw transfer]




STU_A_2(3CKX)
STK24_HUMAN
[Raw transfer]




IEO_A_3(4BIB)
?
[Raw transfer]




STU_B_4(2CLQ)

[Raw transfer]




STU_A_2(3A61)
KS6B1_HUMAN
[Raw transfer]




GOL_B_4(4FZD)
MST4_HUMAN
[Raw transfer]




23D_B_5(2F57)

[Raw transfer]




ATP_A_3(3A7H)
STK24_HUMAN
[Raw transfer]




J60_A_3(2XIK)
STK25_HUMAN
[Raw transfer]




ATP_B_4(3A7H)
STK24_HUMAN
[Raw transfer]




ANP_D_20(2VWI)
OXSR1_HUMAN
[Raw transfer]




DW1_A_2(3FY0)
PAK1_HUMAN
[Raw transfer]




DKI_A_13(2J51)
SLK_HUMAN
[Raw transfer]




ADE_A_2(3A7I)
STK24_HUMAN
[Raw transfer]




EDO_A_5(2J0I)
PAK4_HUMAN
[Raw transfer]




EDO_A_4(2J0I)
PAK4_HUMAN
[Raw transfer]




TRS_A_4(2F57)
PAK7_HUMAN
[Raw transfer]




EDO_A_10(2Q0N)
PAK4_HUMAN
[Raw transfer]




8 PsiBlast_PDB 92.9898%-115 - C1 -3Q4Z 5.8 PAK1_HUMAN
125 HHSearch 92.93100%-110 - C1 -3FXZ 7.2 ?
2 PsiBlast_PDB 91.7498%-106 - C1 -3Q53 3.9 PAK1_HUMAN
6 PsiBlast_PDB 89.5599%-108 - C1 -3FY0 5.3 PAK1_HUMAN
123 HHSearch 80.0145% -99 - C1 -4FIE 5.8 PAK4_HUMAN
19 PsiBlast_PDB 76.9853%-104 - C1 -2X4Z 7.8
11 PsiBlast_PDB 76.3452%-108 - C1 -2CDZ 6.6 PAK4_HUMAN
12 PsiBlast_PDB 74.3852%-104 - C1 -2J0I 3.6 PAK4_HUMAN
18 PsiBlast_PDB 73.9852%-102 - C1 -2Q0N 2.7 PAK4_HUMAN
20 PsiBlast_PDB 72.7253%-101 - C1 -4APP 8.0
14 PsiBlast_PDB 72.5852%-103 - C1 -4FIG 6.5 ?
13 PsiBlast_PDB 72.3152% -96 - C1 -4FIF 5.8 PAK4_HUMAN
30 PsiBlast_CBE 63.0044% -99 - C1 -3GGF 7.8 MST4_HUMAN
32 PsiBlast_CBE 61.3144%-104 - C1 -4FZD 2.1 MST4_HUMAN
33 PsiBlast_CBE 60.5744% -95 - C1 -4FZA 2.3 MST4_HUMAN
31 PsiBlast_CBE 60.3544% -94 - C1 -4FZF 5.4 ?
29 PsiBlast_CBE 59.8444% -95 - C1 -3GGF 8.1 MST4_HUMAN
23 PsiBlast_CBE 58.5940% -72 - C1 -4FIE 5.7 PAK4_HUMAN
50 PsiBlast_CBE 58.4041%-103 - C1 -3DAK 4.1 OXSR1_HUMAN
48 PsiBlast_CBE 57.2241%-103 - C1 -3DAK 4.5 OXSR1_HUMAN
43 PsiBlast_CBE 56.7341%-105 - C1 -2VWI 4.3 OXSR1_HUMAN
49 PsiBlast_CBE 56.3841%-103 - C1 -3DAK 4.2 OXSR1_HUMAN
27 PsiBlast_CBE 56.1452% -74 - C1 -2F57 4.0 PAK7_HUMAN
42 PsiBlast_CBE 55.9240% -95 - C1 -2J51 5.0 SLK_HUMAN
73 PsiBlast_CBE 55.1932%-112 - C1 -4BIE 4.6 ?
78 PsiBlast_CBE 53.8132%-107 - C1 -4BIB 4.6 ?
79 PsiBlast_CBE 53.7232%-109 - C1 -4BIB 4.8 ?
75 PsiBlast_CBE 53.2032%-112 - C1 -4BID 8.6 ?
25 PsiBlast_CBE 52.9752% -70 - C1 -4FIF 6.2 PAK4_HUMAN
26 PsiBlast_CBE 52.7752% -68 - C1 -2F57 5.8
70 PsiBlast_CBE 52.3232%-108 - C1 -4BF2 7.5 ?
77 PsiBlast_CBE 52.2132%-110 - C1 -4BIC 4.4 ?
74 PsiBlast_CBE 51.6632%-108 - C1 -4BID 8.4 ?
72 PsiBlast_CBE 51.5732%-111 - C1 -4BIE 4.4 ?
76 PsiBlast_CBE 51.1732%-106 - C1 -4BIC 5.6 ?
68 PsiBlast_CBE 51.1033%-111 - C1 -2CLQ 7.2 M3K5_HUMAN
67 PsiBlast_CBE 51.0933%-107 - C1 -2CLQ 7.4
71 PsiBlast_CBE 50.7032%-111 - C1 -4BF2 6.8 ?
24 PsiBlast_CBE 50.5952% -67 - C1 -4FIG 6.4 ?
112 PsiBlast_CBE 50.5631%-106 - C1 -3A61 6.7 KS6B1_HUMAN
39 PsiBlast_CBE 41.7944% -62 - C1 -2XIK 6.1 STK25_HUMAN
35 PsiBlast_CBE 40.7645% -61 - C1 -3A7J 5.9 STK24_HUMAN
36 PsiBlast_CBE 40.7245% -62 - C1 -3A7I 4.2 STK24_HUMAN
40 PsiBlast_CBE 40.0245% -63 - C1 -3CKX 8.2 STK24_HUMAN
37 PsiBlast_CBE 38.0645% -57 - C1 -3A7H 4.4 STK24_HUMAN
38 PsiBlast_CBE 37.4845% -55 - C1 -3A7H 4.3 STK24_HUMAN