@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PIM3_HUMAN: (2013-07-24 )
MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGGFGTVYAGSRIADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFLLVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDLRSGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGVPESCDLRLCTLDPDDVASTTSSSESL

Atome Classification :

(75 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

985_A_2(2XJ2)
PIM1_HUMAN
[Raw transfer]




XJ1_A_2(2XJ1)
PIM1_HUMAN
[Raw transfer]




LXG_A_2(3JXW)
PIM1_HUMAN
[Raw transfer]




55E_A_2(3DCV)
PIM1_HUMAN
[Raw transfer]




985_A_2(3F2A)
PIM1_HUMAN
[Raw transfer]




ME3_A_2(2BZJ)
PIM1_HUMAN
[Raw transfer]




UNM_A_2(3R02)
PIM1_HUMAN
[Raw transfer]




1DR_A_3(3JPV)
PIM1_HUMAN
[Raw transfer]




R9P_A_3(4ALV)
PIM1_HUMAN
[Raw transfer]




596_A_4(3UMW)
PIM1_HUMAN
[Raw transfer]




GOL_A_3(4ENY)
PIM1_HUMAN
[Raw transfer]




UNJ_A_3(3R00)
PIM1_HUMAN
[Raw transfer]




DWC_A_3(3BWF)
PIM1_HUMAN
[Raw transfer]




HY7_A_3(4ALW)
PIM1_HUMAN
[Raw transfer]




Q17_A_2(3UIX)
PIM1_HUMAN
[Raw transfer]




DW2_B_2(2BZI)
PIM1_HUMAN
[Raw transfer]




XIY_A_2(2XIY)
PIM1_HUMAN
[Raw transfer]




0FK_A_2(3VBV)
PIM1_HUMAN
[Raw transfer]




XIZ_A_2(2XIZ)
PIM1_HUMAN
[Raw transfer]




LYG_A_2(3JY0)
PIM1_HUMAN
[Raw transfer]




JN5_A_4(3CY3)
PIM1_HUMAN
[Raw transfer]




JM1_X_3(2OI4)
PIM1_HUMAN
[Raw transfer]




GOL_A_5(2XIY)
PIM1_HUMAN
[Raw transfer]




3T9_A_2(3T9I)
PIM1_HUMAN
[Raw transfer]




79O_A_3(4ALU)
PIM1_HUMAN
[Raw transfer]




HB1_B_2(2BZH)
PIM1_HUMAN
[Raw transfer]




VRV_A_2(2OBJ)
PIM1_HUMAN
[Raw transfer]




NM8_A_3(3QF9)
PIM1_HUMAN
[Raw transfer]




ANP_B_3(2BZK)
PIM1_HUMAN
[Raw transfer]




MB9_A_4(3CY2)
PIM1_HUMAN
[Raw transfer]




C4E_B_8(3C4E)
PIM1_HUMAN
[Raw transfer]




LY4_B_3(2J2I)
PIM1_HUMAN
[Raw transfer]




QUE_A_4(2O3P)
PIM1_HUMAN
[Raw transfer]




ANP_A_2(1YXT)
PIM1_HUMAN
[Raw transfer]




AMP_L_12(1YXU)
PIM1_HUMAN
[Raw transfer]




1OB_A_3(4K18)
PIM1_HUMAN
[Raw transfer]




01I_A_3(3MA3)
PIM1_HUMAN
[Raw transfer]




C4E_D_12(3C4E)
PIM1_HUMAN
[Raw transfer]




UNQ_A_2(3R04)
PIM1_HUMAN
[Raw transfer]




C4E_C_10(3C4E)
PIM1_HUMAN
[Raw transfer]




MYU_A_4(2O64)
PIM1_HUMAN
[Raw transfer]




UNE_A_3(3R01)
PIM1_HUMAN
[Raw transfer]




E46_A_2(4A7C)
PIM1_HUMAN
[Raw transfer]




STU_A_5(2Y94)
AAPK1_RAT
[Raw transfer]




IYZ_B_3(2C3I)
PIM1_HUMAN
[Raw transfer]




1OA_A_2(4K0Y)
PIM1_HUMAN
[Raw transfer]




1OC_A_3(4K1B)
PIM1_HUMAN
[Raw transfer]




ANP_A_3(3A99)
PIM1_HUMAN
[Raw transfer]




VX1_A_2(3BGP)
PIM1_HUMAN
[Raw transfer]




LWG_A_2(3JYA)
PIM1_HUMAN
[Raw transfer]




LI7_A_3(1YXX)
PIM1_HUMAN
[Raw transfer]




LI6_A_3(1YXV)
PIM1_HUMAN
[Raw transfer]




0FO_A_2(3VBX)
PIM1_HUMAN
[Raw transfer]




ANP_A_2(4BL1)
MELK_HUMAN
[Raw transfer]




7CP_A_4(3CXW)
PIM1_HUMAN
[Raw transfer]




C4E_A_6(3C4E)
PIM1_HUMAN
[Raw transfer]




J19_A_5(4ENY)
PIM1_HUMAN
[Raw transfer]




Z20_A_3(4ENX)
PIM1_HUMAN
[Raw transfer]




3RA_A_3(4GW8)
PIM1_HUMAN
[Raw transfer]




ANP_A_4(1XR1)
PIM1_HUMAN
[Raw transfer]




MYF_A_3(2O65)
PIM1_HUMAN
[Raw transfer]




HB1_A_3(2IWI)
PIM2_HUMAN
[Raw transfer]




MYC_A_5(2O63)
PIM1_HUMAN
[Raw transfer]




AMP_I_9(1YXU)
PIM1_HUMAN
[Raw transfer]




RPS_A_2(4AS0)
PIM1_HUMAN
[Raw transfer]




0FN_A_2(3VBW)
PIM1_HUMAN
[Raw transfer]




PFQ_A_2(3K5U)
AURKA_HUMAN
[Raw transfer]




AMP_K_11(1YXU)
PIM1_HUMAN
[Raw transfer]




VX2_A_2(3BGQ)
PIM1_HUMAN
[Raw transfer]




HB1_B_4(2IWI)
PIM2_HUMAN
[Raw transfer]




NHJ_A_2(4DEB)
AURKA_HUMAN
[Raw transfer]




AMP_J_10(1YXU)
PIM1_HUMAN
[Raw transfer]




EDO_A_3(3CY3)
PIM1_HUMAN
[Raw transfer]




ZZL_A_2(2WTW)
AURKA_HUMAN
[Raw transfer]




EPE_X_7(2OI4)
PIM1_HUMAN
[Raw transfer]




OFI_A_2(3LAU)
AURKA_HUMAN
[Raw transfer]




XIX_A_2(2XIX)
PIM1_HUMAN
[Raw transfer]




EDO_X_4(2OI4)
PIM1_HUMAN
[Raw transfer]




14 PsiBlast_PDB 88.0969%-121 - C1 -3DCV 6.0 PIM1_HUMAN
65 PsiBlast_CBE 88.0775%-129 - C1 -4K18 7.7 PIM1_HUMAN
21 PsiBlast_CBE 87.5169%-122 - C1 -2J2I 8.3 PIM1_HUMAN
66 PsiBlast_CBE 86.9675%-130 - C1 -4K0Y 7.3 PIM1_HUMAN
68 PsiBlast_CBE 86.8575%-131 - C1 -3C4E 4.6 PIM1_HUMAN
4 PsiBlast_PDB 86.6669%-121 - C1 -3BGQ 7.2 PIM1_HUMAN
12 PsiBlast_PDB 86.5769%-119 - C1 -2OI4 8.8 PIM1_HUMAN
35 PsiBlast_CBE 86.2871%-122 - C1 -3VBV 4.9 PIM1_HUMAN
70 PsiBlast_CBE 86.0575%-125 - C1 -3C4E 5.3 PIM1_HUMAN
67 PsiBlast_CBE 86.0275%-130 - C1 -4K1B 8.2 PIM1_HUMAN
8 PsiBlast_PDB 85.8669%-122 - C1 -2BZJ 8.6 PIM1_HUMAN
49 PsiBlast_CBE 85.8171%-120 - C1 -1YXX 5.6 PIM1_HUMAN
17 PsiBlast_PDB 85.7969%-126 - C1 -3CY2 5.5 PIM1_HUMAN
11 PsiBlast_PDB 85.7269%-121 - C1 -2BZH 8.6 PIM1_HUMAN
73 PsiBlast_CBE 85.6675%-132 - C1 -4AS0 5.6 PIM1_HUMAN
18 PsiBlast_PDB 85.6469%-123 - C1 -3JPV 6.0 PIM1_HUMAN
54 PsiBlast_CBE 85.6071%-121 - C1 -1YXU 3.8 PIM1_HUMAN
48 PsiBlast_CBE 85.4771%-121 - C1 -2O3P 6.0 PIM1_HUMAN
38 PsiBlast_CBE 85.4671%-127 - C1 -3R02 7.2 PIM1_HUMAN
41 PsiBlast_CBE 85.4471%-122 - C1 -3A99 4.7 PIM1_HUMAN
19 PsiBlast_PDB 85.3569%-124 - C1 -3QF9 7.1 PIM1_HUMAN
3 PsiBlast_PDB 85.2269%-121 - C1 -3BGP 7.1 PIM1_HUMAN
51 PsiBlast_CBE 85.1571%-123 - C1 -1YXU 4.4 PIM1_HUMAN
16 PsiBlast_PDB 85.1269%-123 - C1 -3CXW 6.0 PIM1_HUMAN
50 PsiBlast_CBE 85.0471%-122 - C1 -1YXV 4.1 PIM1_HUMAN
52 PsiBlast_CBE 84.9071%-122 - C1 -1YXU 4.5 PIM1_HUMAN
69 PsiBlast_CBE 84.7875%-128 - C1 -3C4E 4.9 PIM1_HUMAN
71 PsiBlast_CBE 84.6075%-128 - C1 -3C4E 5.3 PIM1_HUMAN
13 PsiBlast_PDB 84.6069%-120 - C1 -3BWF 8.5 PIM1_HUMAN
9 PsiBlast_PDB 84.5969%-124 - C1 -2BZK 5.1 PIM1_HUMAN
2 PsiBlast_PDB 84.5369%-118 - C1 -2OBJ 5.6 PIM1_HUMAN
33 PsiBlast_CBE 84.4071%-122 - C1 -3VBX 4.7 PIM1_HUMAN
40 PsiBlast_CBE 84.1671%-122 - C1 -3R00 5.0 PIM1_HUMAN
31 PsiBlast_CBE 84.1071%-121 - C1 -1XR1 4.2 PIM1_HUMAN
37 PsiBlast_CBE 84.0271%-122 - C1 -3R04 6.5 PIM1_HUMAN
20 PsiBlast_PDB 83.8869%-122 - C1 -4GW8 6.1 PIM1_HUMAN
6 PsiBlast_PDB 83.8669%-121 - C1 -4ALW 6.4 PIM1_HUMAN
44 PsiBlast_CBE 83.4771%-122 - C1 -3JXW 6.1 PIM1_HUMAN
45 PsiBlast_CBE 83.3671%-118 - C1 -2O65 5.7 PIM1_HUMAN
47 PsiBlast_CBE 83.3371%-120 - C1 -2O63 5.7 PIM1_HUMAN
5 PsiBlast_PDB 83.2869%-121 - C1 -4ALV 7.7 PIM1_HUMAN
24 PsiBlast_CBE 82.9570%-123 - C1 -4ENX 6.4 PIM1_HUMAN
42 PsiBlast_CBE 82.8171%-119 - C1 -3JYA 5.5 PIM1_HUMAN
26 PsiBlast_CBE 82.7170%-121 - C1 -3UIX 6.4 PIM1_HUMAN
15 PsiBlast_PDB 82.7169%-123 - C1 -3T9I 7.7 PIM1_HUMAN
53 PsiBlast_CBE 82.5771%-118 - C1 -1YXU 3.9 PIM1_HUMAN
64 PsiBlast_CBE 82.5169%-116 - C1 -2XIY 3.5 PIM1_HUMAN
46 PsiBlast_CBE 82.2871%-121 - C1 -2O64 6.4 PIM1_HUMAN
25 PsiBlast_CBE 82.2670%-126 - C1 -3UMW 7.3 PIM1_HUMAN
34 PsiBlast_CBE 82.2171%-122 - C1 -3VBW 4.2 PIM1_HUMAN
32 PsiBlast_CBE 82.1271%-119 - C1 -3VC4 - PIM1_HUMAN
55 PsiBlast_CBE 82.0971%-115 - C1 -1YXT 5.3 PIM1_HUMAN
43 PsiBlast_CBE 82.0671%-121 - C1 -3JY0 5.8 PIM1_HUMAN
23 PsiBlast_CBE 81.6970%-124 - C1 -4ENY 6.3 PIM1_HUMAN
10 PsiBlast_PDB 81.3169%-119 - C1 -2C3I 7.4 PIM1_HUMAN
39 PsiBlast_CBE 80.9871%-121 - C1 -3R01 5.1 PIM1_HUMAN
60 PsiBlast_CBE 80.7771%-108 - C1 -3F2A 7.4 PIM1_HUMAN
61 PsiBlast_CBE 80.6869%-115 - C1 -2XJ2 7.6 PIM1_HUMAN
58 PsiBlast_CBE 80.3470%-114 - C1 -4A7C 6.4 PIM1_HUMAN
62 PsiBlast_CBE 79.7069%-114 - C1 -2XJ1 7.2 PIM1_HUMAN
63 PsiBlast_CBE 79.5569%-114 - C1 -2XIZ 4.2 PIM1_HUMAN
74 PsiBlast_CBE 79.5069%-116 - C1 -4ALU 5.5 PIM1_HUMAN
22 PsiBlast_CBE 79.1469%-112 - C1 -3CY3 7.4 PIM1_HUMAN
72 PsiBlast_CBE 77.0568%-108 - C1 -2XIX 3.3 PIM1_HUMAN
27 PsiBlast_CBE 76.5569%-111 - C1 -2BZI 8.5 PIM1_HUMAN
75 PsiBlast_CBE 75.2064%-128 - C1 -2IWI 8.0 PIM2_HUMAN
29 PsiBlast_CBE 73.0769%-114 - C1 -3MA3 6.2 PIM1_HUMAN
76 PsiBlast_CBE 70.4464%-129 - C1 -2IWI 8.3 PIM2_HUMAN
93 PsiBlast_CBE 51.0431%-116 - C1 -2WTW 5.9 AURKA_HUMAN
81 PsiBlast_CBE 50.8932%-122 - C1 -4BL1 5.3 MELK_HUMAN
88 PsiBlast_CBE 49.6031%-117 - C1 -3K5U 4.4 AURKA_HUMAN
92 PsiBlast_CBE 47.6131%-123 - C1 -3LAU 5.4 AURKA_HUMAN
128 HHSearch 45.8831%-123 - C1 -4GV1 - AKT1_HUMAN
138 HHSearch 45.7732%-120 - C1 -2Y94 6.4 AAPK1_RAT
108 PsiBlast_CBE 45.4031%-114 - C1 -4DEB 5.0 AURKA_HUMAN