@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : ACVR1_HUMAN: (2015-10-02 )
MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC

Atome Classification :

(35 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

QIG_A_2(3GXL)
TGFR1_HUMAN
[Raw transfer]




855_A_2(3HMM)
TGFR1_HUMAN
[Raw transfer]




LDN_C_20(3Q4U)
ACVR1_HUMAN
[Raw transfer]




ZZG_A_2(2WOT)
TGFR1_HUMAN
[Raw transfer]




IYZ_A_4(4DYM)
ACVR1_HUMAN
[Raw transfer]




LDN_B_13(3Q4U)
ACVR1_HUMAN
[Raw transfer]




507_A_4(3OOM)
ACVR1_HUMAN
[Raw transfer]




LDN_A_5(3Q4U)
ACVR1_HUMAN
[Raw transfer]




LDN_A_5(3Q4U)
ACVR1_HUMAN
[Raw transfer]




3WO_A_2(4X2K)
TGFR1_HUMAN
[Raw transfer]




ZZF_A_3(2WOU)
TGFR1_HUMAN
[Raw transfer]




844_A_5(4BGG)
ACVR1_HUMAN
[Raw transfer]




PY1_C_3(1PY5)
TGFR1_HUMAN
[Raw transfer]




844_C_14(4BGG)
ACVR1_HUMAN
[Raw transfer]




3WN_A_2(4X2J)
TGFR1_HUMAN
[Raw transfer]




A3F_A_17(3MTF)
ACVR1_HUMAN
[Raw transfer]




844_B_10(4BGG)
ACVR1_HUMAN
[Raw transfer]




085_A_2(3TZM)
TGFR1_HUMAN
[Raw transfer]




844_D_16(4BGG)
ACVR1_HUMAN
[Raw transfer]




LDN_C_6(3MDY)
BMR1B_HUMAN
[Raw transfer]




GVD_B_10(3SOC)
AVR2A_HUMAN
[Raw transfer]




TAK_A_10(4C02)
ACVR1_HUMAN
[Raw transfer]




580_B_2(1RW8)
TGFR1_HUMAN
[Raw transfer]




LDN_A_5(3MDY)
BMR1B_HUMAN
[Raw transfer]




LDN_A_5(3MDY)
BMR1B_HUMAN
[Raw transfer]




TAK_A_3(3Q4T)
AVR2A_HUMAN
[Raw transfer]




TAK_A_3(3H9R)
ACVR1_HUMAN
[Raw transfer]




GVD_A_3(3SOC)
AVR2A_HUMAN
[Raw transfer]




GVD_A_3(3SOC)
AVR2A_HUMAN
[Raw transfer]




TAK_B_17(3Q4T)
AVR2A_HUMAN
[Raw transfer]




3WK_A_2(4X2G)
?
[Raw transfer]




3WA_A_2(4X0M)
TGFR1_HUMAN
[Raw transfer]




6OJ_B_8(4ASX)
AVR2A_HUMAN
[Raw transfer]




6OJ_A_3(4ASX)
AVR2A_HUMAN
[Raw transfer]




ADE_A_4(2QLU)
AVR2B_HUMAN
[Raw transfer]




TRS_A_4(4X2G)
?
[Raw transfer]




2 PsiBlast_PDB 95.3199%-115 - C1 -4C02 7.1 ACVR1_HUMAN
1 PsiBlast_PDB 95.1499%-113 - C1 -3H9R 7.8 ACVR1_HUMAN
25 PsiBlast_CBE 91.2999%-107 - C1 -3Q4U 8.9 ACVR1_HUMAN
22 PsiBlast_CBE 91.2499%-110 - C1 -4BGG 8.1 ACVR1_HUMAN
4 PsiBlast_PDB 90.8299%-107 - C1 -3OOM 7.5 ACVR1_HUMAN
26 PsiBlast_CBE 90.1399%-111 - C1 -3Q4U 8.8 ACVR1_HUMAN
3 PsiBlast_PDB 90.1399%-107 - C1 -3MTF 7.4 ACVR1_HUMAN
7 PsiBlast_PDB 90.0499%-109 - C1 -4DYM 6.6 ACVR1_HUMAN
21 PsiBlast_CBE 89.9399%-109 - C1 -4BGG 8.1 ACVR1_HUMAN
6 PsiBlast_PDB 89.7399%-108 - C1 -4BGG 8.0 ACVR1_HUMAN
88 HHSearch 89.6699%-109 - C1 -3Q4U 8.6 ACVR1_HUMAN
5 PsiBlast_PDB 89.6699%-109 - C1 -3Q4U 8.6 ACVR1_HUMAN
23 PsiBlast_CBE 89.5499%-109 - C1 -4BGG 8.2 ACVR1_HUMAN
16 PsiBlast_PDB 84.9866%-109 - C1 -2WOU 6.3 TGFR1_HUMAN
14 PsiBlast_PDB 84.5266%-106 - C1 -3TZM 7.6 TGFR1_HUMAN
19 PsiBlast_PDB 84.4466%-106 - C1 -3GXL 8.1 TGFR1_HUMAN
15 PsiBlast_PDB 84.0166%-107 - C1 -2WOT 9.2 TGFR1_HUMAN
20 PsiBlast_PDB 83.6766%-108 - C1 -3HMM 8.1 TGFR1_HUMAN
69 PsiBlast_CBE 81.9566%-109 - C1 -4X0M 3.2 TGFR1_HUMAN
18 PsiBlast_PDB 81.8466%-107 - C1 -1RW8 7.3 TGFR1_HUMAN
13 PsiBlast_PDB 81.6964%-101 - C1 -3MDY 8.6 BMR1B_HUMAN
90 HHSearch 81.5764%-100 * C1 *3MDY 8.6 BMR1B_HUMAN
17 PsiBlast_PDB 81.5266%-107 - C1 -4X2G 4.0 ?
65 PsiBlast_CBE 81.3464%-102 - C1 -3MDY 8.6 BMR1B_HUMAN
68 PsiBlast_CBE 81.0666%-106 - C1 -4X2J 5.5 TGFR1_HUMAN
67 PsiBlast_CBE 81.0666%-106 - C1 -4X2K 5.5 TGFR1_HUMAN
9 PsiBlast_PDB 78.9666%-102 - C1 -1PY5 6.1 TGFR1_HUMAN
75 PsiBlast_CBE 74.1440%-101 - C1 -3Q4T 7.7 AVR2A_HUMAN
70 PsiBlast_CBE 73.6040% -99 - C1 -4ASX 5.4 AVR2A_HUMAN
72 PsiBlast_CBE 73.2040%-100 - C1 -3SOC 7.1 AVR2A_HUMAN
71 PsiBlast_CBE 72.9140% -99 - C1 -4ASX 5.4 AVR2A_HUMAN
74 PsiBlast_CBE 72.3940%-101 - C1 -3Q4T 7.3 AVR2A_HUMAN
73 PsiBlast_CBE 72.0340% -97 - C1 -3SOC 7.2 AVR2A_HUMAN
76 PsiBlast_CBE 71.5338% -95 - C1 -2QLU 3.0 AVR2B_HUMAN
92 HHSearch 71.5239% -91 - C1 -3SOC 7.2 AVR2A_HUMAN