@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : CDK17_HUMAN: (2015-10-04 )
MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRIHRRISMEDLNKRLSLPADIRIPDGYLEKLQINSPPFDQPMSRRSRRASLSEIGFGKMETYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDDCGNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGISSNEEFKNYNFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF

Atome Classification :

(102 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EZV_A_2(3EZV)
CDK2_HUMAN
[Raw transfer]




07Z_A_2(3RK5)
CDK2_HUMAN
[Raw transfer]




3O0_B_5(3O0G)
CDK5_HUMAN
[Raw transfer]




X64_A_6(4GCJ)
CDK2_HUMAN
[Raw transfer]




20Z_A_2(3RMF)
CDK2_HUMAN
[Raw transfer]




X64_A_3(3QXP)
CDK2_HUMAN
[Raw transfer]




X43_A_2(3QTX)
CDK2_HUMAN
[Raw transfer]




03Z_A_2(3RAK)
CDK2_HUMAN
[Raw transfer]




38R_A_3(4BGQ)
CDKL5_HUMAN
[Raw transfer]




04Z_A_2(3RAL)
CDK2_HUMAN
[Raw transfer]




X46_A_2(3QTS)
CDK2_HUMAN
[Raw transfer]




X36_A_2(3QTR)
CDK2_HUMAN
[Raw transfer]




X3A_A_8(3QTW)
CDK2_HUMAN
[Raw transfer]




08Z_A_3(3RK7)
CDK2_HUMAN
[Raw transfer]




99Z_A_3(3SQQ)
CDK2_HUMAN
[Raw transfer]




X14_A_4(3QRT)
CDK2_HUMAN
[Raw transfer]




56Z_A_2(3S1H)
CDK2_HUMAN
[Raw transfer]




X44_A_2(3QTU)
CDK2_HUMAN
[Raw transfer]




Z62_A_2(3R8V)
CDK2_HUMAN
[Raw transfer]




EZR_A_2(3EZR)
CDK2_HUMAN
[Raw transfer]




X40_A_6(3QU0)
CDK2_HUMAN
[Raw transfer]




Z14_A_3(3R83)
CDK2_HUMAN
[Raw transfer]




ADP_A_4(3NIZ)
?
[Raw transfer]




Z68_A_2(3R9N)
CDK2_HUMAN
[Raw transfer]




ADP_A_4(3NIZ)
?
[Raw transfer]




09Z_A_2(3RK9)
CDK2_HUMAN
[Raw transfer]




X35_A_3(3QTQ)
CDK2_HUMAN
[Raw transfer]




Z31_A_2(3R8U)
CDK2_HUMAN
[Raw transfer]




N20_A_5(1OI9)
CDK2_HUMAN
[Raw transfer]




ANP_C_3(1J1B)
GSK3B_HUMAN
[Raw transfer]




O1Z_A_2(3RAH)
CDK2_HUMAN
[Raw transfer]




Z67_A_2(3R9H)
CDK2_HUMAN
[Raw transfer]




INR_B_4(1V0O)
CDC2H_PLAFK
[Raw transfer]




ADP_A_4(2B9H)
FUS3_YEAST
[Raw transfer]




ATP_E_5(1UA2)
CDK7_HUMAN
[Raw transfer]




X02_A_7(3QQK)
CDK2_HUMAN
[Raw transfer]




12Z_A_3(3RKB)
CDK2_HUMAN
[Raw transfer]




Z63_A_2(3R8Z)
CDK2_HUMAN
[Raw transfer]




X63_A_3(3QX2)
CDK2_HUMAN
[Raw transfer]




4SP_A_5(2IW8)
CDK2_HUMAN
[Raw transfer]




18Z_A_3(3RM6)
CDK2_HUMAN
[Raw transfer]




INR_A_3(1V0O)
CDC2H_PLAFK
[Raw transfer]




50Z_A_2(3S0O)
CDK2_HUMAN
[Raw transfer]




X6B_A_2(3R9D)
CDK2_HUMAN
[Raw transfer]




X85_A_3(3RAI)
CDK2_HUMAN
[Raw transfer]




X42_A_4(3QTZ)
CDK2_HUMAN
[Raw transfer]




06Z_A_2(3RJC)
CDK2_HUMAN
[Raw transfer]




26Z_A_3(3RPV)
CDK2_HUMAN
[Raw transfer]




X87_A_3(3R73)
CDK2_HUMAN
[Raw transfer]




25Z_A_2(3RPR)
CDK2_HUMAN
[Raw transfer]




Z71_A_2(3R9O)
CDK2_HUMAN
[Raw transfer]




21Z_A_2(3RNI)
CDK2_HUMAN
[Raw transfer]




X19_A_3(3QRU)
CDK2_HUMAN
[Raw transfer]




STU_A_2(4EZ7)
CDK2_HUMAN
[Raw transfer]




Z04_A_3(3R7Y)
CDK2_HUMAN
[Raw transfer]




02Z_A_2(3RZB)
CDK2_HUMAN
[Raw transfer]




X86_A_3(3R71)
CDK2_HUMAN
[Raw transfer]




LZ9_A_4(4Y72)
?
[Raw transfer]




DRK_A_3(3EB0)
?
[Raw transfer]




X6A_A_3(3QWJ)
CDK2_HUMAN
[Raw transfer]




X84_A_3(3R6X)
CDK2_HUMAN
[Raw transfer]




ALH_A_5(1UNG)
CDK5_HUMAN
[Raw transfer]




27Z_A_2(3RPY)
CDK2_HUMAN
[Raw transfer]




RRC_A_5(1UNL)
CDK5_HUMAN
[Raw transfer]




X65_A_3(3QXO)
CDK2_HUMAN
[Raw transfer]




Z46_A_2(3R8P)
CDK2_HUMAN
[Raw transfer]




PVB_B_4(1V0P)
CDC2H_PLAFK
[Raw transfer]




ST8_A_5(1OGU)
CDK2_HUMAN
[Raw transfer]




19Z_A_3(3RM7)
CDK2_HUMAN
[Raw transfer]




X72_A_3(3QZI)
CDK2_HUMAN
[Raw transfer]




X03_A_2(3QQL)
CDK2_HUMAN
[Raw transfer]




X88_A_3(3R7E)
CDK2_HUMAN
[Raw transfer]




Z02_A_3(3R7V)
CDK2_HUMAN
[Raw transfer]




PVB_A_3(1V0P)
CDC2H_PLAFK
[Raw transfer]




X62_A_6(3QWK)
CDK2_HUMAN
[Raw transfer]




X66_A_2(3QZF)
CDK2_HUMAN
[Raw transfer]




24Z_A_3(3RPO)
CDK2_HUMAN
[Raw transfer]




X4B_A_4(3QX4)
CDK2_HUMAN
[Raw transfer]




X0A_A_6(3QQH)
CDK2_HUMAN
[Raw transfer]




Z30_A_2(3R8L)
CDK2_HUMAN
[Raw transfer]




X96_A_3(3R7U)
CDK2_HUMAN
[Raw transfer]




X01_A_3(3QL8)
CDK2_HUMAN
[Raw transfer]




X69_A_3(3QZH)
CDK2_HUMAN
[Raw transfer]




X07_A_3(3QQF)
CDK2_HUMAN
[Raw transfer]




X76_A_3(3R1Y)
CDK2_HUMAN
[Raw transfer]




Z60_A_2(3S00)
CDK2_HUMAN
[Raw transfer]




0S0_A_2(4EZ3)
CDK2_HUMAN
[Raw transfer]




X73_A_3(3R1S)
CDK2_HUMAN
[Raw transfer]




X67_A_4(3QZG)
CDK2_HUMAN
[Raw transfer]




Z19_A_3(3R8M)
CDK2_HUMAN
[Raw transfer]




X11_A_3(3QQJ)
CDK2_HUMAN
[Raw transfer]




X75_A_3(3R1Q)
CDK2_HUMAN
[Raw transfer]




X06_A_3(3QQG)
CDK2_HUMAN
[Raw transfer]




Z3R_B_10(4AU8)
CDK5_HUMAN
[Raw transfer]




Z3R_A_6(4AU8)
CDK5_HUMAN
[Raw transfer]




Z3R_A_6(4AU8)
CDK5_HUMAN
[Raw transfer]




22Z_A_3(3ROY)
CDK2_HUMAN
[Raw transfer]




XA0_A_3(3R28)
CDK2_HUMAN
[Raw transfer]




X9I_A_3(3R7I)
CDK2_HUMAN
[Raw transfer]




1CK_A_2(4EK4)
CDK2_HUMAN
[Raw transfer]




0SR_A_3(4F6U)
CDK8_HUMAN
[Raw transfer]




2AN_A_3(4EZ7)
CDK2_HUMAN
[Raw transfer]




EDO_A_3(4EZ3)
CDK2_HUMAN
[Raw transfer]




41 PsiBlast_CBE 83.9853%-114 - C1 -3RM7 4.6 CDK2_HUMAN
42 PsiBlast_CBE 82.9753%-111 - C1 -3RM6 5.3 CDK2_HUMAN
100 PsiBlast_CBE 82.8853%-111 - C1 -3QQF 4.4 CDK2_HUMAN
73 PsiBlast_CBE 82.6953%-112 - C1 -3R1S 4.9 CDK2_HUMAN
74 PsiBlast_CBE 82.6853%-109 - C1 -3R1Q 5.6 CDK2_HUMAN
83 PsiBlast_CBE 82.4153%-112 - C1 -3QWK 5.9 CDK2_HUMAN
38 PsiBlast_CBE 82.3353%-109 - C1 -3ROY 5.4 CDK2_HUMAN
69 PsiBlast_CBE 82.3053%-110 - C1 -3R71 4.9 CDK2_HUMAN
76 PsiBlast_CBE 82.2653%-111 - C1 -3QZH 4.9 CDK2_HUMAN
81 PsiBlast_CBE 82.1853%-112 - C1 -3QX4 4.8 CDK2_HUMAN
94 PsiBlast_CBE 82.1653%-112 - C1 -3QRT 6.0 CDK2_HUMAN
80 PsiBlast_CBE 82.0053%-111 - C1 -3QXO 4.4 CDK2_HUMAN
67 PsiBlast_CBE 81.9453%-113 - C1 -3R7E 4.2 CDK2_HUMAN
75 PsiBlast_CBE 81.7453%-110 - C1 -3QZI 5.1 CDK2_HUMAN
71 PsiBlast_CBE 81.6653%-109 - C1 -3R28 5.3 CDK2_HUMAN
95 PsiBlast_CBE 81.6353%-111 - C1 -3QQL 4.9 CDK2_HUMAN
39 PsiBlast_CBE 81.4953%-110 - C1 -3RNI 4.7 CDK2_HUMAN
61 PsiBlast_CBE 81.4853%-115 - C1 -3R8L 4.8 CDK2_HUMAN
68 PsiBlast_CBE 81.3453%-109 - C1 -3R73 5.0 CDK2_HUMAN
77 PsiBlast_CBE 81.2553%-115 - C1 -3QZG 5.1 CDK2_HUMAN
78 PsiBlast_CBE 81.2453%-109 - C1 -3QZF 4.6 CDK2_HUMAN
37 PsiBlast_CBE 81.2053%-110 - C1 -3RPO 5.0 CDK2_HUMAN
46 PsiBlast_CBE 81.1553%-110 - C1 -3RK5 5.4 CDK2_HUMAN
72 PsiBlast_CBE 81.1253%-110 - C1 -3R1Y 4.3 CDK2_HUMAN
84 PsiBlast_CBE 81.0953%-109 - C1 -3QWJ 4.8 CDK2_HUMAN
32 PsiBlast_CBE 81.0853%-113 - C1 -3S00 4.3 CDK2_HUMAN
50 PsiBlast_CBE 81.0753%-109 - C1 -3RAI 5.5 CDK2_HUMAN
54 PsiBlast_CBE 81.0653%-112 - C1 -3R9H 4.9 CDK2_HUMAN
101 PsiBlast_CBE 81.0453%-108 - C1 -3QL8 5.5 CDK2_HUMAN
93 PsiBlast_CBE 80.9753%-108 - C1 -3QRU 5.5 CDK2_HUMAN
70 PsiBlast_CBE 80.9653%-109 - C1 -3R6X 5.1 CDK2_HUMAN
59 PsiBlast_CBE 80.8353%-111 - C1 -3R8P 4.3 CDK2_HUMAN
44 PsiBlast_CBE 80.7953%-109 - C1 -3RK9 4.9 CDK2_HUMAN
20 PsiBlast_PDB 80.7853%-105 - C1 -1OI9 6.3 CDK2_HUMAN
43 PsiBlast_CBE 80.7753%-110 - C1 -3RKB 4.9 CDK2_HUMAN
96 PsiBlast_CBE 80.7453%-109 - C1 -3QQK 4.2 CDK2_HUMAN
66 PsiBlast_CBE 80.6953%-114 - C1 -3R7I 4.6 CDK2_HUMAN
58 PsiBlast_CBE 80.6953%-110 - C1 -3R8U 5.0 CDK2_HUMAN
82 PsiBlast_CBE 80.6853%-110 - C1 -3QX2 4.6 CDK2_HUMAN
65 PsiBlast_CBE 80.6853%-114 - C1 -3R7U 4.3 CDK2_HUMAN
92 PsiBlast_CBE 80.6553%-108 - C1 -3QTQ 4.5 CDK2_HUMAN
64 PsiBlast_CBE 80.5953%-113 - C1 -3R7V 4.0 CDK2_HUMAN
36 PsiBlast_CBE 80.5253%-115 - C1 -3RPR 6.6 CDK2_HUMAN
90 PsiBlast_CBE 80.4653%-115 - C1 -3QTS 5.2 CDK2_HUMAN
19 PsiBlast_PDB 80.3853%-102 - C1 -1OGU 6.0 CDK2_HUMAN
55 PsiBlast_CBE 80.3553%-108 - C1 -3R9D 5.7 CDK2_HUMAN
51 PsiBlast_CBE 80.3553%-113 - C1 -3RAH 6.0 CDK2_HUMAN
63 PsiBlast_CBE 80.3253%-112 - C1 -3R7Y 5.4 CDK2_HUMAN
85 PsiBlast_CBE 80.3153%-111 - C1 -3QU0 5.7 CDK2_HUMAN
99 PsiBlast_CBE 80.1953%-110 - C1 -3QQG 5.7 CDK2_HUMAN
86 PsiBlast_CBE 80.1653%-109 - C1 -3QTZ 5.3 CDK2_HUMAN
57 PsiBlast_CBE 80.1153%-111 - C1 -3R8V 5.0 CDK2_HUMAN
53 PsiBlast_CBE 80.0553%-114 - C1 -3R9N 5.9 CDK2_HUMAN
79 PsiBlast_CBE 80.0253%-110 - C1 -3QXP 5.7 CDK2_HUMAN
47 PsiBlast_CBE 79.9953%-112 - C1 -3RJC 5.9 CDK2_HUMAN
45 PsiBlast_CBE 79.9253%-109 - C1 -3RK7 5.8 CDK2_HUMAN
62 PsiBlast_CBE 79.7853%-112 - C1 -3R83 5.5 CDK2_HUMAN
88 PsiBlast_CBE 79.7453%-106 - C1 -3QTW 5.8 CDK2_HUMAN
35 PsiBlast_CBE 79.6753%-110 - C1 -3RPV 5.8 CDK2_HUMAN
31 PsiBlast_CBE 79.5653%-110 - C1 -3S0O 4.2 CDK2_HUMAN
89 PsiBlast_CBE 79.5453%-109 - C1 -3QTU 5.2 CDK2_HUMAN
29 PsiBlast_CBE 79.5353%-111 - C1 -3SQQ 5.8 CDK2_HUMAN
56 PsiBlast_CBE 79.3553%-115 - C1 -3R8Z 4.0 CDK2_HUMAN
97 PsiBlast_CBE 79.3253%-107 - C1 -3QQJ 5.3 CDK2_HUMAN
87 PsiBlast_CBE 79.2153%-110 - C1 -3QTX 4.6 CDK2_HUMAN
98 PsiBlast_CBE 78.9853%-110 - C1 -3QQH 7.0 CDK2_HUMAN
28 PsiBlast_CBE 78.9753%-110 - C1 -4EZ3 4.2 CDK2_HUMAN
91 PsiBlast_CBE 78.7953%-109 - C1 -3QTR 6.0 CDK2_HUMAN
34 PsiBlast_CBE 78.7353%-117 - C1 -3RPY 4.3 CDK2_HUMAN
18 PsiBlast_PDB 78.7253%-111 - C1 -3EZV 7.0 CDK2_HUMAN
49 PsiBlast_CBE 78.5953%-117 - C1 -3RAK 5.5 CDK2_HUMAN
15 PsiBlast_PDB 78.5954%-110 - C1 -1V0P 8.1 CDC2H_PLAFK
121 HHSearch 78.5557%-102 - C1 -4AU8 5.0 CDK5_HUMAN
60 PsiBlast_CBE 78.4853%-111 - C1 -3R8M 3.8 CDK2_HUMAN
16 PsiBlast_PDB 78.4453%-104 - C1 -2IW8 6.6 CDK2_HUMAN
52 PsiBlast_CBE 78.1753%-109 - C1 -3R9O 5.9 CDK2_HUMAN
30 PsiBlast_CBE 78.1653%-116 - C1 -3S1H 5.9 CDK2_HUMAN
17 PsiBlast_PDB 77.8353%-116 - C1 -3EZR 7.0 CDK2_HUMAN
33 PsiBlast_CBE 77.8153%-112 - C1 -3RZB 4.7 CDK2_HUMAN
26 PsiBlast_CBE 77.6753%-100 - C1 -4GCJ 5.5 CDK2_HUMAN
11 PsiBlast_PDB 77.3252%-105 - C1 -3NIZ 4.8 ?
40 PsiBlast_CBE 77.1753%-116 - C1 -3RMF 7.1 CDK2_HUMAN
48 PsiBlast_CBE 76.9153%-118 - C1 -3RAL 6.0 CDK2_HUMAN
7 PsiBlast_PDB 76.8355%-104 - C1 -4AU8 5.0 CDK5_HUMAN
25 PsiBlast_CBE 76.6754%-118 - C1 -1V0P 7.2 CDC2H_PLAFK
27 PsiBlast_CBE 76.5253%-101 - C1 -4EZ7 8.8 CDK2_HUMAN
127 HHSearch 76.4752%-104 - C1 -3NIZ 4.8 ?
3 PsiBlast_PDB 75.4455%-108 - C1 -1UNG 5.1 CDK5_HUMAN
5 PsiBlast_PDB 75.2655%-104 - C1 -1UNL 6.4 CDK5_HUMAN
24 PsiBlast_CBE 75.2254%-105 - C1 -1V0O 6.0 CDC2H_PLAFK
23 PsiBlast_CBE 75.1055%-109 - C1 -4AU8 4.8 CDK5_HUMAN
13 PsiBlast_PDB 74.7154%-108 - C1 -1V0O 6.0 CDC2H_PLAFK
21 PsiBlast_CBE 72.5455%-110 - C1 -3O0G 6.6 CDK5_HUMAN
8 PsiBlast_PDB 72.5054%-100 - C1 -4Y72 7.0 ?
126 HHSearch 66.8631% -96 - C1 -1J1B 4.3 GSK3B_HUMAN
113 HHSearch 66.2832% -91 - C1 -3EB0 6.4 ?
130 HHSearch 66.2134% -98 - C1 -2B9H 5.6 FUS3_YEAST
115 HHSearch 61.3439% -94 - C1 -1UA2 5.1 CDK7_HUMAN
132 HHSearch 60.2339%-107 - C1 -4F6U 9.0 CDK8_HUMAN
133 HHSearch 59.2737%-102 - C1 -4BGQ 8.0 CDKL5_HUMAN
131 HHSearch 58.0936%-109 - C1 -2FST - MK14_HUMAN